BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1021 (500 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 23 1.5 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 6.2 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 21 8.2 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 23.0 bits (47), Expect = 1.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +1 Query: 310 YCIFVTREIIYEIRKSLFDLANVFDSVIIFSYVFI 414 YC I ++ L D +V S+ +FS+ F+ Sbjct: 188 YCFRNDNSEILKMATQLVDFKSVIRSISVFSFFFM 222 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.0 bits (42), Expect = 6.2 Identities = 14/59 (23%), Positives = 30/59 (50%) Frame = +1 Query: 280 FVLISFHSLVYCIFVTREIIYEIRKSLFDLANVFDSVIIFSYVFIMLGRLKCVFVYIIV 456 F+ + ++V+ +F R + Y+ +AN F + + +F++L + VF +IV Sbjct: 84 FIALIVVNIVH-VFRKRRVNYKDSNIGLVVANAFFLLWTPAVIFVVLSKNGIVFAGLIV 141 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 20.6 bits (41), Expect = 8.2 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = +1 Query: 457 TYKVVINNQT 486 TYK+ +NNQ+ Sbjct: 483 TYKITVNNQS 492 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,086 Number of Sequences: 336 Number of extensions: 2615 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11839801 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -