BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1021 (500 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 2.5 AF203336-1|AAF19831.1| 187|Anopheles gambiae immune-responsive ... 23 4.4 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 23 5.8 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 24.2 bits (50), Expect = 2.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 178 TIQYYNIITGIINNFSYLLNTLYSLRLQNLL 86 T+ YY + T +YL T+ +LRL LL Sbjct: 20 TVYYYYLFTQCNPLSTYLYRTILALRLVTLL 50 >AF203336-1|AAF19831.1| 187|Anopheles gambiae immune-responsive chymotrypsin-likeserine protease-related protein ISPR1 protein. Length = 187 Score = 23.4 bits (48), Expect = 4.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 351 PYFINNFSSYKN 316 PYFI+ FS+Y N Sbjct: 111 PYFIDRFSNYDN 122 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 23.0 bits (47), Expect = 5.8 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -1 Query: 317 IQYTSE*NDIRTKHIHGPVNSTIKNY 240 I T N + T+H H PVN N+ Sbjct: 358 IYTTPSSNSLSTQHSHSPVNGYGNNH 383 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 473,344 Number of Sequences: 2352 Number of extensions: 9396 Number of successful extensions: 58 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44823054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -