BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1021 (500 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ320497-1|CAC60121.1| 4523|Homo sapiens axonemal beta heavy cha... 33 0.42 AC005078-1|AAC78616.2| 1020|Homo sapiens Homo sapiens dynein, ax... 33 0.42 >AJ320497-1|CAC60121.1| 4523|Homo sapiens axonemal beta heavy chain dynein type 11 protein. Length = 4523 Score = 33.5 bits (73), Expect = 0.42 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +1 Query: 253 VLLTGP*MCFVLISFHSLVYCIFVTREIIYEIRKSLFDLANVFDSVIIFS 402 +L +GP + I+FH + C F+ I + +L DL+NVF ++ S Sbjct: 2682 ILRSGPTLIQATIAFHQTMMCNFLPTAIKFHYIFNLRDLSNVFQGILFAS 2731 >AC005078-1|AAC78616.2| 1020|Homo sapiens Homo sapiens dynein, axonemal, heavy polypeptide 11 (DNAH11) protein. Length = 1020 Score = 33.5 bits (73), Expect = 0.42 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +1 Query: 253 VLLTGP*MCFVLISFHSLVYCIFVTREIIYEIRKSLFDLANVFDSVIIFS 402 +L +GP + I+FH + C F+ I + +L DL+NVF ++ S Sbjct: 661 ILRSGPTLIQATIAFHQTMMCNFLPTAIKFHYIFNLRDLSNVFQGILFAS 710 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,685,446 Number of Sequences: 237096 Number of extensions: 1158474 Number of successful extensions: 1524 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1521 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4593178062 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -