BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1021 (500 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 23 1.8 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 2.4 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 23 2.4 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 23 2.4 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 23 2.4 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 3.1 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 7.2 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 7.2 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 21 9.5 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 23.0 bits (47), Expect = 1.8 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 305 SE*NDIRTKHIHGPVNSTIKNYALLRSIRIYYTRIILP 192 SE NDI GP++S ++ + SI + Y + ILP Sbjct: 18 SEINDIVGFLKKGPLDSNVEVVVGVPSIYLTYAKNILP 55 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = -2 Query: 163 NIITGIINNFSYLLNTLYS 107 +++TG+ N +Y++NT YS Sbjct: 189 SVVTGMNNIETYIVNTNYS 207 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = -2 Query: 163 NIITGIINNFSYLLNTLYS 107 +++TG+ N +Y++NT YS Sbjct: 189 SVVTGMNNIETYIVNTNYS 207 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 22.6 bits (46), Expect = 2.4 Identities = 10/25 (40%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = -1 Query: 89 TSVLIE--RVKGTHFVKI*SYELVP 21 +S+++E ++GTH+VKI Y +P Sbjct: 280 SSIIMELHNIEGTHYVKIVYYLGIP 304 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 22.6 bits (46), Expect = 2.4 Identities = 10/25 (40%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = -1 Query: 89 TSVLIE--RVKGTHFVKI*SYELVP 21 +S+++E ++GTH+VKI Y +P Sbjct: 295 SSIIMELHNIEGTHYVKIVYYLGIP 319 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.2 bits (45), Expect = 3.1 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -1 Query: 212 YTRIILPLRTDNDTIL 165 Y R+I P+ +NDT++ Sbjct: 32 YNRLIRPVSNNNDTVV 47 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.0 bits (42), Expect = 7.2 Identities = 9/31 (29%), Positives = 12/31 (38%) Frame = +2 Query: 152 GDNVVILYRYQFVRVILYECNIYGWIVVVHN 244 GD + Y + L N GW + HN Sbjct: 183 GDTADMKKTYNNIDYYLLAANYTGWYLTKHN 213 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.0 bits (42), Expect = 7.2 Identities = 9/31 (29%), Positives = 12/31 (38%) Frame = +2 Query: 152 GDNVVILYRYQFVRVILYECNIYGWIVVVHN 244 GD + Y + L N GW + HN Sbjct: 183 GDTADMKKTYNNIDYYLLAANYTGWYLTKHN 213 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -1 Query: 326 VTKIQYTSE*NDIRTKHIHGPVNSTIKN 243 + K+ Y + ND+ + + VN IKN Sbjct: 383 IQKVIYGFDFNDVNFRILIANVNDLIKN 410 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,423 Number of Sequences: 438 Number of extensions: 3070 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -