BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1020 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 23 3.4 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 6.0 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 56 NVLSKRKLPIMSFTRTKAAYEG 121 ++L LP+ SF R++ Y+G Sbjct: 31 HLLGSSSLPLRSFYRSRIRYQG 52 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.8 bits (44), Expect = 6.0 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +1 Query: 28 NVSKYNK-AYQRF-IKKKTSYYEFYTYQSSVRRR 123 N++K N A RF KK YY FY + R R Sbjct: 160 NLNKNNVVATGRFTFHKKNLYYSFYISDKAARPR 193 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,198 Number of Sequences: 336 Number of extensions: 3545 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -