BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1019 (550 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeo... 25 1.6 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 5.0 >AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeotic protein protein. Length = 324 Score = 25.0 bits (52), Expect = 1.6 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -3 Query: 503 GSVQQVRGWHFRGQRQGRQRVHDQVH--PQHL 414 G+ Q H G QG++ +QVH PQH+ Sbjct: 154 GTAQMTIPQHHMGHSQGQECYPEQVHQTPQHM 185 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.4 bits (48), Expect = 5.0 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = +3 Query: 255 QLLVDREGGDVGP---QRVRLHRXVPAV-PAHRQRGGPSSWPLSEHAP 386 ++++ R G GP R L R V + P H P SWP+S AP Sbjct: 436 RVVMSRLRGSPGPPETDRAELERIVSDLFPTHP----PVSWPVSSDAP 479 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 524,954 Number of Sequences: 2352 Number of extensions: 9767 Number of successful extensions: 28 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -