BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1018 (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11000.1 68417.m01789 ankyrin repeat family protein contains ... 29 3.9 At5g43880.1 68418.m05366 expressed protein 27 9.0 At3g26780.1 68416.m03350 phosphoglycerate/bisphosphoglycerate mu... 27 9.0 At3g11240.1 68416.m01367 arginine-tRNA-protein transferase, puta... 27 9.0 >At4g11000.1 68417.m01789 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 406 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 537 KWSLVFGTILMGKCERLLVYNSFFTSSYLYYNYIS 641 KW L++G++ L Y++ F SSY +Y+S Sbjct: 326 KWKLLYGSVAALSIAALASYSTIFPSSYDANSYLS 360 >At5g43880.1 68418.m05366 expressed protein Length = 836 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 5/35 (14%) Frame = +3 Query: 6 YLXPFESKPTSPARGAP-----CRPTNEALAEAWS 95 Y PF S P S A G+P CR + L+E W+ Sbjct: 357 YDSPFSSSPFSRASGSPESSSVCREAKKRLSERWA 391 >At3g26780.1 68416.m03350 phosphoglycerate/bisphosphoglycerate mutase family protein similar to X4 protein GI:21386798, Y4 protein GI:21386800 from [Silene dioica]; contains Pfam profiles PF00300: phosphoglycerate mutase family, PF01535: PPR repeat Length = 1053 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 90 TPPPEPRSLVGRVRRGQERLALTQKVL 10 +PPP+P S+ R+ G E A+T+ L Sbjct: 88 SPPPQPPSIFSRIVSGDEDRAVTEVYL 114 >At3g11240.1 68416.m01367 arginine-tRNA-protein transferase, putative / arginyltransferase, putative / arginyl-tRNA-protein transferase, putative similar to SP|Q9ZT48 Arginine-tRNA-protein transferase 1 (EC 2.3.2.8) (R-transferase 1) (Arginyltransferase 1) (Arginyl-tRNA--protein transferase 1) {Arabidopsis thaliana}; contains Pfam profiles PF04377: Arginine-tRNA-protein transferase C terminus, PF04376: Arginine-tRNA-protein transferase N terminus Length = 605 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -2 Query: 279 NLTHKSTIYYYY*KYALRKCTKLLQK 202 N H ST+ YYY Y + C K+ K Sbjct: 432 NQAHCSTLEYYYLGYYIHSCNKMRYK 457 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,720,362 Number of Sequences: 28952 Number of extensions: 233166 Number of successful extensions: 461 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -