BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1017 (520 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32520| Best HMM Match : G_glu_transpept (HMM E-Value=4.9e-12) 29 3.0 SB_49700| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.0 >SB_32520| Best HMM Match : G_glu_transpept (HMM E-Value=4.9e-12) Length = 1225 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +2 Query: 14 EPKPTSPARGAPCRLANEALAETHWNRRTGHRPTS*ANPANT*KFQF 154 EP+ +P+ G + THW R+ + T A N+ KF+F Sbjct: 607 EPRLYNPSSGRTMYSKAQVQQRTHWKSRSNMQSTRSATGRNSSKFKF 653 >SB_49700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 7645 Score = 27.5 bits (58), Expect = 7.0 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +1 Query: 40 RCTLPISERGSGGDALEPSYRSPTYILGESSQYIKVPVL 156 R TL G D +P+ T+ GE+ + +K+P+L Sbjct: 997 RITLNEGSAKDGQDYSQPAVLQDTFAPGETDKVVKIPIL 1035 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,531,581 Number of Sequences: 59808 Number of extensions: 241406 Number of successful extensions: 480 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 441 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 480 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1160542895 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -