BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1013 (550 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 24 3.8 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 8.8 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 23.8 bits (49), Expect = 3.8 Identities = 6/19 (31%), Positives = 12/19 (63%) Frame = +3 Query: 183 YSIYCRLGPILHCRHVWLV 239 Y + CR+G + HC + ++ Sbjct: 286 YELNCRVGEVFHCTNTSII 304 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 22.6 bits (46), Expect = 8.8 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +3 Query: 24 SQPHLPAVHPADQRTRLWQPSPSPSVLSYPNSTISYTS 137 + PH + ++ PSP P+ + P+S I TS Sbjct: 724 TSPHGAPLALTSSKSASTHPSPHPATRASPSSPIVATS 761 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 533,100 Number of Sequences: 2352 Number of extensions: 10110 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -