BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1013 (550 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U21317-5|AAA62526.2| 895|Caenorhabditis elegans Hypothetical pr... 29 2.9 Z50110-2|CAA90446.1| 566|Caenorhabditis elegans Hypothetical pr... 28 5.1 Z50110-1|CAA90444.1| 692|Caenorhabditis elegans Hypothetical pr... 28 5.1 Z81098-6|CAB03180.3| 610|Caenorhabditis elegans Hypothetical pr... 27 8.9 AL031632-3|CAA21006.1| 283|Caenorhabditis elegans Hypothetical ... 27 8.9 >U21317-5|AAA62526.2| 895|Caenorhabditis elegans Hypothetical protein B0495.7 protein. Length = 895 Score = 28.7 bits (61), Expect = 2.9 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 30 PHLPAVH---PADQRTRLWQPSPSPSVLSYP 113 P+ A+H P +Q LW P PSP VL YP Sbjct: 714 PYYTAIHELFPPEQS--LWVPVPSPVVLPYP 742 >Z50110-2|CAA90446.1| 566|Caenorhabditis elegans Hypothetical protein F18H3.3b protein. Length = 566 Score = 27.9 bits (59), Expect = 5.1 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +3 Query: 54 ADQRTRLWQPSPSPSVLSYP-NSTISYTSLILLDVSEATVCAE*YSIYCRLGPILHCR 224 A Q + Q P P+ + YP N+T S SL + D+ A + + GP+L R Sbjct: 30 AGQPQAVIQQGPPPTNIGYPPNATYSMASLYIGDLHPDVSEAMLFEKFSMAGPVLSIR 87 >Z50110-1|CAA90444.1| 692|Caenorhabditis elegans Hypothetical protein F18H3.3a protein. Length = 692 Score = 27.9 bits (59), Expect = 5.1 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +3 Query: 54 ADQRTRLWQPSPSPSVLSYP-NSTISYTSLILLDVSEATVCAE*YSIYCRLGPILHCR 224 A Q + Q P P+ + YP N+T S SL + D+ A + + GP+L R Sbjct: 30 AGQPQAVIQQGPPPTNIGYPPNATYSMASLYIGDLHPDVSEAMLFEKFSMAGPVLSIR 87 >Z81098-6|CAB03180.3| 610|Caenorhabditis elegans Hypothetical protein K07A12.4a protein. Length = 610 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 15 SSQSQPHLPAVHPADQRTRLWQPSPSPSVLSYPNSTISYT 134 S ++ P LPA HP + P +P+ + P +++S T Sbjct: 55 SGRNSPALPAPHPGIPSSSYHPPVSTPTPTAAPTTSLSST 94 >AL031632-3|CAA21006.1| 283|Caenorhabditis elegans Hypothetical protein Y32B12B.3 protein. Length = 283 Score = 27.1 bits (57), Expect = 8.9 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 89 FPFCSLLPKFNYFLHV 136 +PFC+ KF YFLH+ Sbjct: 55 YPFCASFNKFYYFLHL 70 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,446,579 Number of Sequences: 27780 Number of extensions: 213868 Number of successful extensions: 550 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 531 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1113119490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -