BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1010 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 29 0.036 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 21 9.7 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 29.1 bits (62), Expect = 0.036 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +2 Query: 62 KVCSHXLLEVPLSXISMGNMTSKRSLALIKGKLESR 169 K+C + L E+P +S+ + T K LAL+ + SR Sbjct: 316 KICFYWLNEIPTMPVSIKDQTIKEELALLAQQSTSR 351 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 551 VXISTILSYFEXHALXIIAY 610 V I T LSYF + I+AY Sbjct: 53 VYIGTDLSYFISNVYQILAY 72 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,062 Number of Sequences: 336 Number of extensions: 1801 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -