BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1008 (500 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125962-1|AAD14741.1| 341|Caenorhabditis elegans Seven tm rece... 29 2.5 AF078786-3|AAC26943.2| 384|Caenorhabditis elegans Hypothetical ... 27 7.6 >AF125962-1|AAD14741.1| 341|Caenorhabditis elegans Seven tm receptor protein 113 protein. Length = 341 Score = 28.7 bits (61), Expect = 2.5 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 450 YILYYICIKDFRXPYIHLFTNYISIAQYSRY 358 + L+Y I+ F P IH++ N I + Q R+ Sbjct: 53 FSLFYTSIETFLRPLIHIYDNTIFVIQRKRF 83 >AF078786-3|AAC26943.2| 384|Caenorhabditis elegans Hypothetical protein M01G5.3 protein. Length = 384 Score = 27.1 bits (57), Expect = 7.6 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -3 Query: 435 ICIKDFRXPYIHLFTNYISIAQYSR 361 +C ++FR PY +FT YIS+ Q ++ Sbjct: 218 LCYQEFR-PYFLIFTFYISLVQLAQ 241 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,698,434 Number of Sequences: 27780 Number of extensions: 160936 Number of successful extensions: 354 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 351 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 956602620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -