BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1004 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 1.1 X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 26 1.4 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 25 2.5 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 26.2 bits (55), Expect = 1.1 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 274 ERNPDIATGNTVRTDKAPTARCILRR 351 E+ DIATGNTVR A R +L R Sbjct: 1263 EQTIDIATGNTVRKAIAADGREVLDR 1288 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 25.8 bits (54), Expect = 1.4 Identities = 11/39 (28%), Positives = 15/39 (38%) Frame = +3 Query: 438 EWNGTTLQFYNRNFNSPTPSVSGRTGKIYQGWNPETDTW 554 EWN QFY F+ P ++ R + Q W Sbjct: 170 EWNDERKQFYLHQFHKKQPDLNYRNPAVVQAMKDVLRFW 208 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 25.0 bits (52), Expect = 2.5 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 525 QGWNPETDTWDIKQSTASQEIHKLRKLEL 611 +GW P+ IK++ E+H R L+L Sbjct: 708 KGWGPDYPRQSIKETPCWVEVHLHRALQL 736 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 752,223 Number of Sequences: 2352 Number of extensions: 15716 Number of successful extensions: 37 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -