BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1002 (750 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g48040.1 68415.m06013 expressed protein 28 5.8 At4g16950.1 68417.m02556 disease resistance protein (TIR-NBS-LRR... 28 7.6 >At2g48040.1 68415.m06013 expressed protein Length = 294 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +1 Query: 67 RSNPRLICRNPESSSTWLTPDSIFVRLVSYL 159 +++ +LIC ++S WL PD++ R + L Sbjct: 63 KNDIQLICCQADASVLWLVPDTVVTRFIQSL 93 >At4g16950.1 68417.m02556 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein.; closest homolog in Col-0 to RPP5 of clutivar Landsberg erecta. Length = 1449 Score = 27.9 bits (59), Expect = 7.6 Identities = 21/57 (36%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = +3 Query: 309 YLPSRVMALETTVTYPTSSDSPYIFSGEACLDLDKKKQGHKTSVRYL-INISNNRNQ 476 Y R TVT P SS S +ACL +D +G K RYL +N N Q Sbjct: 1241 YFTYRAYGDSLTVTLPRSSLSQSFLRFKACLVVDPLSEG-KGFYRYLEVNFGFNGKQ 1296 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,963,526 Number of Sequences: 28952 Number of extensions: 376568 Number of successful extensions: 1106 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1106 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -