BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1001 (423 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1294 - 36076524-36076554,36076821-36076891,36077221-360772... 98 2e-21 05_05_0108 + 22451440-22451541,22452228-22452427,22452979-22453018 98 3e-21 04_04_1144 + 31222556-31222633,31223238-31227665,31227724-312277... 29 1.2 09_01_0024 + 438288-438542,439020-439069,440096-440351 29 2.0 03_06_0682 - 35516081-35518303 28 3.6 11_02_0038 - 7631462-7634428,7635975-7636250 27 4.7 03_05_0169 + 21474655-21474771,21474879-21474971,21475553-214756... 27 8.2 >01_06_1294 - 36076524-36076554,36076821-36076891,36077221-36077275, 36077363-36077562,36078614-36078715 Length = 152 Score = 98.3 bits (234), Expect = 2e-21 Identities = 48/74 (64%), Positives = 56/74 (75%) Frame = +1 Query: 118 RPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAK 297 RP+ KG TK FVR L+REVVG A YEKR ELLKV KDKRALK KR+LGTH RAK Sbjct: 28 RPSDRKGKSTKRVNFVRGLIREVVGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAK 87 Query: 298 RKREELSNVLAQMR 339 +KREE++ V+ +MR Sbjct: 88 KKREEMAGVIRKMR 101 >05_05_0108 + 22451440-22451541,22452228-22452427,22452979-22453018 Length = 113 Score = 97.9 bits (233), Expect = 3e-21 Identities = 48/74 (64%), Positives = 56/74 (75%) Frame = +1 Query: 118 RPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAK 297 RP+ KG TK FVR+L+REV G A YEKR ELLKV KDKRALK KR+LGTH RAK Sbjct: 28 RPSDRKGKSTKRVTFVRNLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAK 87 Query: 298 RKREELSNVLAQMR 339 +KREE++ VL +MR Sbjct: 88 KKREEMAGVLRKMR 101 >04_04_1144 + 31222556-31222633,31223238-31227665,31227724-31227789, 31227790-31228014,31228097-31228255,31228393-31228551, 31228855-31229013,31229371-31229490,31229604-31229825 Length = 1871 Score = 29.5 bits (63), Expect = 1.2 Identities = 22/94 (23%), Positives = 48/94 (51%) Frame = +1 Query: 49 EKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAMELL 228 E +Q + ++ + +A + + A L+ + S+ ++LV E +G EK+ +ELL Sbjct: 621 EADLEQYRSKVSQLSDELEAYQTKAASLEAVMESASEKEKELV-ESLGQITEEKKKLELL 679 Query: 229 KVSKDKRALKFLKRRLGTHIRAKRKREELSNVLA 330 + +++ ++LK + +R + + S VLA Sbjct: 680 VLEYEEKTEEYLKEKQSLE---ERLQSQESKVLA 710 >09_01_0024 + 438288-438542,439020-439069,440096-440351 Length = 186 Score = 28.7 bits (61), Expect = 2.0 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +1 Query: 196 AQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSN 321 A++E R E LK ++++ A K LKR+ + ++KR + +N Sbjct: 122 AEFELRREERLKEAEERTAKKRLKRQKKKQRKKEKKRSKTNN 163 >03_06_0682 - 35516081-35518303 Length = 740 Score = 27.9 bits (59), Expect = 3.6 Identities = 16/73 (21%), Positives = 35/73 (47%), Gaps = 4/73 (5%) Frame = +1 Query: 121 PARLKGLQTKHSKFVRDLVREVVGHAQYEKRAMELLK----VSKDKRALKFLKRRLGTHI 288 P + L+ + F+++++ +++ EKR ELL+ ++K LG+ + Sbjct: 324 PKEVHHLKDLNENFIKEIIERSAFNSEEEKRQSELLEMVGDIAKKCSGSPLAATALGSTL 383 Query: 289 RAKRKREELSNVL 327 R K ++E +L Sbjct: 384 RTKTTKKEWEAIL 396 >11_02_0038 - 7631462-7634428,7635975-7636250 Length = 1080 Score = 27.5 bits (58), Expect = 4.7 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 241 DKRALKFLKRRLGTHIRAKRKREELSNV 324 DK+ LKFL R TH + E+++N+ Sbjct: 791 DKKHLKFLNLRCTTHTKESYTMEDITNI 818 >03_05_0169 + 21474655-21474771,21474879-21474971,21475553-21475642, 21475728-21475811,21476088-21476252,21476995-21477182, 21477363-21477435,21477766-21477819,21478019-21478276, 21478891-21479097,21479293-21479396,21479809-21479953, 21480108-21480242,21480610-21480783 Length = 628 Score = 26.6 bits (56), Expect = 8.2 Identities = 25/89 (28%), Positives = 47/89 (52%), Gaps = 9/89 (10%) Frame = +1 Query: 79 LAARVSQYKAIRIR---PARLKGLQTKHSKFVRDLVR----EVVGHAQYEKRAM--ELLK 231 + R+S+Y+ +R PARL Q S ++R + G + E + + +LLK Sbjct: 238 IVERLSRYRTKLVRLGHPARLLP-QVLDSALDAQVLRADNSSLAGDIRKEMKVLNSKLLK 296 Query: 232 VSKDKRALKFLKRRLGTHIRAKRKREELS 318 +KDK + +++ L T + +RKR++L+ Sbjct: 297 -AKDKNTKRDIRKELRTLAKEERKRQQLA 324 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,827,679 Number of Sequences: 37544 Number of extensions: 178297 Number of successful extensions: 423 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 423 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 778540620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -