BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1001 (423 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR533465-1|CAG38496.1| 105|Homo sapiens RPL36 protein. 124 2e-28 BC091508-1|AAH91508.1| 105|Homo sapiens ribosomal protein L36 p... 124 2e-28 BC004971-1|AAH04971.1| 105|Homo sapiens ribosomal protein L36 p... 124 2e-28 BC003052-1|AAH03052.1| 105|Homo sapiens ribosomal protein L36 p... 124 2e-28 AB061833-1|BAB79471.1| 105|Homo sapiens ribosomal protein L36 p... 124 2e-28 AB046410-1|BAB21256.1| 32|Homo sapiens ribosomal protein L36 p... 64 2e-10 L34600-1|AAA67038.1| 727|Homo sapiens initiation factor 2 protein. 29 8.5 DQ388145-2|ABD72216.1| 1482|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388144-2|ABD72214.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388143-2|ABD72212.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388142-2|ABD72210.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388141-2|ABD72208.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388140-2|ABD72206.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388139-2|ABD72204.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388138-2|ABD72202.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388137-2|ABD72200.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388136-2|ABD72198.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388135-2|ABD72196.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388134-2|ABD72194.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388133-2|ABD72192.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388132-2|ABD72190.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388131-2|ABD72188.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388130-2|ABD72186.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388129-2|ABD72184.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ388128-2|ABD72182.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ356264-2|ABC87066.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ356263-2|ABC87064.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ356262-2|ABC87062.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ356261-2|ABC87060.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ356260-2|ABC87058.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ356259-2|ABC87056.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ356258-2|ABC87054.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ356257-2|ABC87052.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ354391-2|ABC79055.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ354390-2|ABC79053.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ354389-2|ABC79051.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 DQ354388-2|ABC79049.1| 1663|Homo sapiens CTTNBP2 protein. 29 8.5 BC106000-1|AAI06001.1| 1663|Homo sapiens cortactin binding prote... 29 8.5 AF495546-1|AAM70196.1| 727|Homo sapiens translation initiation ... 29 8.5 AF494407-1|AAM14617.1| 727|Homo sapiens mitochondrial translati... 29 8.5 AF377960-1|AAL32176.1| 1663|Homo sapiens cortactin-binding prote... 29 8.5 AB051545-1|BAB21849.1| 1662|Homo sapiens KIAA1758 protein protein. 29 8.5 >CR533465-1|CAG38496.1| 105|Homo sapiens RPL36 protein. Length = 105 Score = 124 bits (298), Expect = 2e-28 Identities = 62/97 (63%), Positives = 78/97 (80%), Gaps = 5/97 (5%) Frame = +1 Query: 67 LKYPLAARVSQYKAI-----RIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAMELLK 231 L+YP+A +++ + + R +R +G TKH+KFVRD++REV G A YE+RAMELLK Sbjct: 3 LRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLK 62 Query: 232 VSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 342 VSKDKRALKF+K+R+GTHIRAKRKREELSNVLA MRK Sbjct: 63 VSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRK 99 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +3 Query: 15 MAPRFEIAVGLRKGHKTTK 71 MA R+ +AVGL KGHK TK Sbjct: 1 MALRYPMAVGLNKGHKVTK 19 >BC091508-1|AAH91508.1| 105|Homo sapiens ribosomal protein L36 protein. Length = 105 Score = 124 bits (298), Expect = 2e-28 Identities = 62/97 (63%), Positives = 78/97 (80%), Gaps = 5/97 (5%) Frame = +1 Query: 67 LKYPLAARVSQYKAI-----RIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAMELLK 231 L+YP+A +++ + + R +R +G TKH+KFVRD++REV G A YE+RAMELLK Sbjct: 3 LRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLK 62 Query: 232 VSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 342 VSKDKRALKF+K+R+GTHIRAKRKREELSNVLA MRK Sbjct: 63 VSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRK 99 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +3 Query: 15 MAPRFEIAVGLRKGHKTTK 71 MA R+ +AVGL KGHK TK Sbjct: 1 MALRYPMAVGLNKGHKVTK 19 >BC004971-1|AAH04971.1| 105|Homo sapiens ribosomal protein L36 protein. Length = 105 Score = 124 bits (298), Expect = 2e-28 Identities = 62/97 (63%), Positives = 78/97 (80%), Gaps = 5/97 (5%) Frame = +1 Query: 67 LKYPLAARVSQYKAI-----RIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAMELLK 231 L+YP+A +++ + + R +R +G TKH+KFVRD++REV G A YE+RAMELLK Sbjct: 3 LRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLK 62 Query: 232 VSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 342 VSKDKRALKF+K+R+GTHIRAKRKREELSNVLA MRK Sbjct: 63 VSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRK 99 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +3 Query: 15 MAPRFEIAVGLRKGHKTTK 71 MA R+ +AVGL KGHK TK Sbjct: 1 MALRYPMAVGLNKGHKVTK 19 >BC003052-1|AAH03052.1| 105|Homo sapiens ribosomal protein L36 protein. Length = 105 Score = 124 bits (298), Expect = 2e-28 Identities = 62/97 (63%), Positives = 78/97 (80%), Gaps = 5/97 (5%) Frame = +1 Query: 67 LKYPLAARVSQYKAI-----RIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAMELLK 231 L+YP+A +++ + + R +R +G TKH+KFVRD++REV G A YE+RAMELLK Sbjct: 3 LRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLK 62 Query: 232 VSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 342 VSKDKRALKF+K+R+GTHIRAKRKREELSNVLA MRK Sbjct: 63 VSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRK 99 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +3 Query: 15 MAPRFEIAVGLRKGHKTTK 71 MA R+ +AVGL KGHK TK Sbjct: 1 MALRYPMAVGLNKGHKVTK 19 >AB061833-1|BAB79471.1| 105|Homo sapiens ribosomal protein L36 protein. Length = 105 Score = 124 bits (298), Expect = 2e-28 Identities = 62/97 (63%), Positives = 78/97 (80%), Gaps = 5/97 (5%) Frame = +1 Query: 67 LKYPLAARVSQYKAI-----RIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAMELLK 231 L+YP+A +++ + + R +R +G TKH+KFVRD++REV G A YE+RAMELLK Sbjct: 3 LRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLK 62 Query: 232 VSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 342 VSKDKRALKF+K+R+GTHIRAKRKREELSNVLA MRK Sbjct: 63 VSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRK 99 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +3 Query: 15 MAPRFEIAVGLRKGHKTTK 71 MA R+ +AVGL KGHK TK Sbjct: 1 MALRYPMAVGLNKGHKVTK 19 >AB046410-1|BAB21256.1| 32|Homo sapiens ribosomal protein L36 protein. Length = 32 Score = 63.7 bits (148), Expect = 2e-10 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +1 Query: 226 LKVSKDKRALKFLKRRLGTHIRAKRKREELSN 321 LKVSKDKRALKF+K+R+GTHIRAKRKREELSN Sbjct: 1 LKVSKDKRALKFIKKRVGTHIRAKRKREELSN 32 >L34600-1|AAA67038.1| 727|Homo sapiens initiation factor 2 protein. Length = 727 Score = 28.7 bits (61), Expect = 8.5 Identities = 21/65 (32%), Positives = 32/65 (49%) Frame = +1 Query: 148 KHSKFVRDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVL 327 K K RE GH ++KR++ L+FL+R+ ++ K KRE SNVL Sbjct: 468 KEHKEAHQKAREKYGHLLWKKRSI-----------LRFLERKEQIPLKPKEKRERDSNVL 516 Query: 328 AQMRK 342 + + K Sbjct: 517 SVIIK 521 >DQ388145-2|ABD72216.1| 1482|Homo sapiens CTTNBP2 protein. Length = 1482 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388144-2|ABD72214.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388143-2|ABD72212.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388142-2|ABD72210.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388141-2|ABD72208.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388140-2|ABD72206.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388139-2|ABD72204.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388138-2|ABD72202.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388137-2|ABD72200.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388136-2|ABD72198.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388135-2|ABD72196.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388134-2|ABD72194.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388133-2|ABD72192.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388132-2|ABD72190.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388131-2|ABD72188.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388130-2|ABD72186.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388129-2|ABD72184.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ388128-2|ABD72182.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ356264-2|ABC87066.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ356263-2|ABC87064.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ356262-2|ABC87062.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ356261-2|ABC87060.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ356260-2|ABC87058.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ356259-2|ABC87056.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ356258-2|ABC87054.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ356257-2|ABC87052.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ354391-2|ABC79055.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ354390-2|ABC79053.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ354389-2|ABC79051.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >DQ354388-2|ABC79049.1| 1663|Homo sapiens CTTNBP2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >BC106000-1|AAI06001.1| 1663|Homo sapiens cortactin binding protein 2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >AF495546-1|AAM70196.1| 727|Homo sapiens translation initiation factor 2 protein. Length = 727 Score = 28.7 bits (61), Expect = 8.5 Identities = 21/65 (32%), Positives = 32/65 (49%) Frame = +1 Query: 148 KHSKFVRDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVL 327 K K RE GH ++KR++ L+FL+R+ ++ K KRE SNVL Sbjct: 468 KEHKEAHQKAREKYGHLLWKKRSI-----------LRFLERKEQIPLKPKEKRERDSNVL 516 Query: 328 AQMRK 342 + + K Sbjct: 517 SVIIK 521 >AF494407-1|AAM14617.1| 727|Homo sapiens mitochondrial translation-initiation factor 2 protein. Length = 727 Score = 28.7 bits (61), Expect = 8.5 Identities = 21/65 (32%), Positives = 32/65 (49%) Frame = +1 Query: 148 KHSKFVRDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVL 327 K K RE GH ++KR++ L+FL+R+ ++ K KRE SNVL Sbjct: 468 KEHKEAHQKAREKYGHLLWKKRSI-----------LRFLERKEQIPLKPKEKRERDSNVL 516 Query: 328 AQMRK 342 + + K Sbjct: 517 SVIIK 521 >AF377960-1|AAL32176.1| 1663|Homo sapiens cortactin-binding protein 2 protein. Length = 1663 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 118 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 163 >AB051545-1|BAB21849.1| 1662|Homo sapiens KIAA1758 protein protein. Length = 1662 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 46 CEKATKQLKYPLAARVSQYKAIRIRPARLKGLQTKHSKFVRDLVRE 183 C+K +++ LAA S+ K + + +L+ L+ +H K L E Sbjct: 117 CKKMQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEE 162 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 51,980,911 Number of Sequences: 237096 Number of extensions: 957607 Number of successful extensions: 1896 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 1872 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1896 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3259265358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -