BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-1000 (600 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ404478-1|CAC16182.1| 77|Anopheles gambiae putative GATA fact... 24 3.3 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 21 3.5 EF034031-1|ABK32002.1| 70|Anopheles gambiae serpin 4A protein. 23 7.5 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 10.0 >AJ404478-1|CAC16182.1| 77|Anopheles gambiae putative GATA factor protein. Length = 77 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/23 (47%), Positives = 12/23 (52%), Gaps = 1/23 (4%) Frame = -3 Query: 583 REXXXGHLPCNACA-FPEPAPGT 518 R GH CNACA + PGT Sbjct: 10 RRDIVGHTLCNACALYTRQNPGT 32 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 21.0 bits (42), Expect(2) = 3.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 Query: 218 GASAPTALVGLSLPPSSKNESVMISGDLEP 129 GAS P L LPP E V EP Sbjct: 629 GASEPVPLASWPLPPPYITEPVEGPAKKEP 658 Score = 21.0 bits (42), Expect(2) = 3.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 143 GDLEPSWTPLM 111 GD PSW PL+ Sbjct: 692 GDNRPSWRPLI 702 >EF034031-1|ABK32002.1| 70|Anopheles gambiae serpin 4A protein. Length = 70 Score = 23.0 bits (47), Expect = 7.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 483 RGTPGGSSTSVLVPGAGSG 539 +GT GG+ T+ L+ GSG Sbjct: 21 QGTEGGAVTAALIDRIGSG 39 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 22.6 bits (46), Expect = 10.0 Identities = 12/38 (31%), Positives = 15/38 (39%) Frame = +3 Query: 477 YFRGTPGGSSTSVLVPGAGSGNAQALHGRCPXXXSRPL 590 Y T GG+ + G G G LHG RP+ Sbjct: 932 YHSSTVGGNKDVLDGGGGGGGGGGFLHGSNRTVIGRPV 969 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 568,770 Number of Sequences: 2352 Number of extensions: 10754 Number of successful extensions: 26 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -