BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0998 (576 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1009 + 23274632-23274841,23274956-23275084,23275207-23275599 30 1.5 01_05_0559 + 23281408-23282457,23282580-23282942,23283938-232839... 28 6.1 >07_03_1009 + 23274632-23274841,23274956-23275084,23275207-23275599 Length = 243 Score = 29.9 bits (64), Expect = 1.5 Identities = 17/37 (45%), Positives = 24/37 (64%) Frame = +1 Query: 31 PRRTLPTSERGSGGDAAETQLRVSLVLNNNNKPSAPS 141 PRR P RGSG AA T++ S +++++KP APS Sbjct: 184 PRR--PVEARGSGS-AATTRMEKSRRMSSSSKPRAPS 217 >01_05_0559 + 23281408-23282457,23282580-23282942,23283938-23283991, 23284088-23284156 Length = 511 Score = 27.9 bits (59), Expect = 6.1 Identities = 20/74 (27%), Positives = 35/74 (47%) Frame = +2 Query: 2 PPXPKSTSPARGAPCRLANEALAETRRRLSSACHSCSTITTSRVHHHVSSLLLIFYVSVR 181 PP + P A +A A++ T LSS + S+I+T+ + SS VS Sbjct: 349 PPVQEVRPPVASATATIAAAAVSSTAVTLSSTTFTSSSISTTTI-SIASSTFSPAAVSST 407 Query: 182 SVQVMRTTNNTSMI 223 ++ + +T +T+ I Sbjct: 408 TIAIAASTISTASI 421 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,253,178 Number of Sequences: 37544 Number of extensions: 184323 Number of successful extensions: 552 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 551 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1340735508 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -