BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0998 (576 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL161712-10|CAC35900.1| 533|Caenorhabditis elegans Hypothetical... 29 2.4 Z81132-13|CAB03427.2| 308|Caenorhabditis elegans Hypothetical p... 27 7.2 >AL161712-10|CAC35900.1| 533|Caenorhabditis elegans Hypothetical protein Y66D12A.13 protein. Length = 533 Score = 29.1 bits (62), Expect = 2.4 Identities = 16/66 (24%), Positives = 28/66 (42%) Frame = +2 Query: 74 TRRRLSSACHSCSTITTSRVHHHVSSLLLIFYVSVRSVQVMRTTNNTSMILISFKSYNLL 253 T + HS + T + Y+ + + V + SM +S+ +Y LL Sbjct: 281 TDTEIEDVVHSAIEVDTKSRAKAKKYSFIHLYIHPK-ITVQTVVASISMFSVSYVTYGLL 339 Query: 254 FNYNIL 271 FNY++L Sbjct: 340 FNYDVL 345 >Z81132-13|CAB03427.2| 308|Caenorhabditis elegans Hypothetical protein T26E4.14 protein. Length = 308 Score = 27.5 bits (58), Expect = 7.2 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +2 Query: 143 VSSLLLIFYVSVRSVQVMRTTNNTSMILISFKSYNLLFNYNIL 271 + SLL+I +V V+ TT N M++++F NL NIL Sbjct: 1 MESLLIILCCIYCTVFVVGTTGNLIMVMVTFYCKNLRSICNIL 43 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,024,001 Number of Sequences: 27780 Number of extensions: 171285 Number of successful extensions: 431 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 431 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1194789454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -