BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0988 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 3.4 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 22 4.5 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 7.8 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 461 TLITNPXYSSKYLR 502 T I N YSSKY+R Sbjct: 199 TYIVNTNYSSKYMR 212 Score = 21.8 bits (44), Expect = 5.9 Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -3 Query: 513 STLTLKYLDEX-SGLVIRVGGECXSLFSGDGSVTLDECGHDTSSSLNTEGKGCY 355 + L ++ +D SG +I G+ +++ +G L S S+NT+ G Y Sbjct: 330 NALEMRLMDAIDSGYLIDEYGKKIDIYTPEGLNMLGNVIEGNSDSINTKFYGMY 383 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 22.2 bits (45), Expect = 4.5 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = -3 Query: 513 STLTLKYLDEX-SGLVIRVGGECXSLFSGDGSVTLDECGHDTSSSLNTEGKGCY 355 + L ++ +D SG +I G+ +++ +G L +S S+NT+ G Y Sbjct: 330 NALEMRLMDAIDSGYLIDEYGKKIDIYTPEGLNMLGNVIEGSSDSINTKFYGMY 383 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 7.8 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 495 YLDEXSGLVIRVGGECXSLFSGDGSVTLDECG 400 Y D + L + C S + G V+ ECG Sbjct: 143 YYDGGANLNLNGTVNCTSSIASSGVVSAGECG 174 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,148 Number of Sequences: 438 Number of extensions: 3140 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -