BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0986 (690 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_1052 + 10821964-10822064,10822434-10822607,10823086-108233... 29 3.5 01_07_0039 - 40667598-40669880 28 8.0 >12_01_1052 + 10821964-10822064,10822434-10822607,10823086-10823346, 10829833-10831798,10832114-10832515 Length = 967 Score = 29.1 bits (62), Expect = 3.5 Identities = 19/61 (31%), Positives = 29/61 (47%) Frame = -1 Query: 474 LKLMRSRKPTNIFLKKTIIFDSLVKENTYKSTSNQECY*NGSVLNY*NSRKVHPTLHNLT 295 +KLM S P +L I D+L+K N ++ ++ + + N S P LHNL Sbjct: 347 VKLMESTSPDG-YLSGARILDTLIKFNRDDASGSELPGQSMQIYNMIGSASSSPILHNLV 405 Query: 294 Q 292 Q Sbjct: 406 Q 406 >01_07_0039 - 40667598-40669880 Length = 760 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -1 Query: 309 LHNLTQCVTR*HTYRTDRDITTCFEL*IRLKPETLQMHRTARS 181 +HNL R ++R D+ T FEL PE LQ T+ S Sbjct: 458 IHNLLMFSHRIPSFRFTCDVGTVFELEHSAVPENLQYENTSAS 500 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,934,793 Number of Sequences: 37544 Number of extensions: 260782 Number of successful extensions: 507 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 507 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -