BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0983 (450 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 25 0.50 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 6.2 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 8.2 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 8.2 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 8.2 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 24.6 bits (51), Expect = 0.50 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 265 PDRPFSESTSLSGYSFWSHIRSKHRAHIDMPL 170 PD+P S S S + S S RS+ + DMP+ Sbjct: 589 PDKPASSSASSAPTSVCSSPRSEDKEVEDMPV 620 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.0 bits (42), Expect = 6.2 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 Query: 57 PPPVLELHDVQRR 19 PPP L+ HD R+ Sbjct: 322 PPPNLDYHDYSRQ 334 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 20.6 bits (41), Expect = 8.2 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 181 RYVRGAWSECDSKTNIRSRKLTL 249 RY+ A+ KTN+ K TL Sbjct: 12 RYITAAFPSACGKTNLAMMKPTL 34 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 20.6 bits (41), Expect = 8.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 232 SRKLTLKKGDPANCEVVKTIQKKC 303 S +LT+K G P N E ++C Sbjct: 121 SSRLTIKAGCPMNLENFPMDTQRC 144 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 20.6 bits (41), Expect = 8.2 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = +1 Query: 37 ELKYWWWMM 63 E+ WWW M Sbjct: 362 EMNKWWWNM 370 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,796 Number of Sequences: 438 Number of extensions: 2843 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -