BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0982 (353 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40708| Best HMM Match : SRCR (HMM E-Value=0) 27 3.3 SB_51687| Best HMM Match : EMP70 (HMM E-Value=0) 27 5.8 SB_6478| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.7 SB_15187| Best HMM Match : PilN (HMM E-Value=7.5) 26 7.7 SB_5138| Best HMM Match : Herpes_UL3 (HMM E-Value=2.3) 26 7.7 >SB_40708| Best HMM Match : SRCR (HMM E-Value=0) Length = 1976 Score = 27.5 bits (58), Expect = 3.3 Identities = 12/50 (24%), Positives = 24/50 (48%) Frame = -2 Query: 223 KRTRMRFCLLCPASYVGPTRLVRISTPQFPTIRLRLSSSVAQRGQSQIQI 74 K+ CL CP Y+G L R+ P +++ ++++ +S +I Sbjct: 1612 KQIEGSICLQCPDGYMGDGELCRVIASIAPEFQVQPANNITTTTESAFRI 1661 >SB_51687| Best HMM Match : EMP70 (HMM E-Value=0) Length = 392 Score = 26.6 bits (56), Expect = 5.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 111 ELNLNRIVGNWGVEIRTNLVG 173 +LN+NR +WG + R N+VG Sbjct: 323 KLNINRKAMSWGYQRRLNIVG 343 >SB_6478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 621 Score = 26.2 bits (55), Expect = 7.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 34 YHRIVLRDNVELFIFESDSDLFEPLTNSISIG*SETGAWR 153 YH I + ++ + SD DL + L S+S+ + GA R Sbjct: 411 YHEIATCNGLDSLLKNSDQDLLKELEESLSLPRTTWGAVR 450 >SB_15187| Best HMM Match : PilN (HMM E-Value=7.5) Length = 310 Score = 26.2 bits (55), Expect = 7.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 34 YHRIVLRDNVELFIFESDSDLFEPLTNSISIG*SETGAWR 153 YH I + ++ + SD DL + L S+S+ + GA R Sbjct: 100 YHEIATCNGLDSLLKNSDQDLLKELEESLSLPRTTWGAVR 139 >SB_5138| Best HMM Match : Herpes_UL3 (HMM E-Value=2.3) Length = 567 Score = 26.2 bits (55), Expect = 7.7 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = +1 Query: 7 RNSVVLVQNYHRIVLRDNVELFIFESDSDLFEPL 108 +++ VLV H ++LR NV +++ ++D + L Sbjct: 364 KDATVLVSLSHVVILRRNVVAYVYSRENDQWRAL 397 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,419,251 Number of Sequences: 59808 Number of extensions: 148330 Number of successful extensions: 317 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 317 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 548040812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -