BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0982 (353 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59140.1 68416.m06593 ABC transporter family protein putative... 31 0.29 At1g04120.1 68414.m00401 ABC transporter family protein Strong s... 29 0.89 At3g21250.1 68416.m02685 ABC transporter family protein similar ... 29 1.2 At2g39950.1 68415.m04909 expressed protein 29 1.2 At3g60970.1 68416.m06823 ABC transporter family protein ABC tran... 28 1.6 At3g60160.1 68416.m06717 ABC transporter family protein similar ... 28 1.6 >At3g59140.1 68416.m06593 ABC transporter family protein putative multi resistance protein mrp - Arabidopsis thaliana, EMBL:ATMRPPROT Length = 1453 Score = 30.7 bits (66), Expect = 0.29 Identities = 12/29 (41%), Positives = 22/29 (75%) Frame = -3 Query: 291 VVTVAHRLPTVIEALIIIAFVEIRELE*D 205 V+TVAHR+PTV++ ++++ + R +E D Sbjct: 1395 VITVAHRIPTVMDCTMVLSISDGRIVEYD 1423 >At1g04120.1 68414.m00401 ABC transporter family protein Strong similarity to MRP-like ABC transporter gb|U92650 from A. thaliana and canalicular multi-drug resistance protein gb|L49379 from Rattus norvegicus Length = 1514 Score = 29.1 bits (62), Expect = 0.89 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = -3 Query: 291 VVTVAHRLPTVIEALIIIAFVEIRELE*DFASYVL 187 V T+AHR+PTVI++ +++ + R E D + +L Sbjct: 1456 VCTIAHRIPTVIDSDLVLVLSDGRVAEFDTPARLL 1490 >At3g21250.1 68416.m02685 ABC transporter family protein similar to MRP-like ABC transporter GB:AAC49791 from [Arabidopsis thaliana] Length = 1294 Score = 28.7 bits (61), Expect = 1.2 Identities = 12/27 (44%), Positives = 23/27 (85%), Gaps = 2/27 (7%) Frame = -3 Query: 291 VVTVAHRLPTVIEA--LIIIAFVEIRE 217 V+TVAHR+PTVI++ +++++F ++ E Sbjct: 1233 VITVAHRVPTVIDSDMVMVLSFGDLVE 1259 >At2g39950.1 68415.m04909 expressed protein Length = 636 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = -1 Query: 200 PPMSCFLCWTDQVGSDLHAPVSDY---PIEIEFVS 105 P S + CW S LHAP + Y P+ IE S Sbjct: 422 PVFSPYYCWCPPTTSSLHAPSASYQFPPLSIELPS 456 >At3g60970.1 68416.m06823 ABC transporter family protein ABC transporter-like proteins Length = 1037 Score = 28.3 bits (60), Expect = 1.6 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = -3 Query: 291 VVTVAHRLPTVIEALIIIAFVEIRELE*DFASYVL 187 VVT+AHR+ TVIE+ +++ + R E D + +L Sbjct: 974 VVTIAHRIHTVIESDLVLVLSDGRIAEFDSPAKLL 1008 >At3g60160.1 68416.m06717 ABC transporter family protein similar to ATP-binding cassette transporter MRP8 GI:18031899 from [Arabidopsis thaliana] Length = 1490 Score = 28.3 bits (60), Expect = 1.6 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = -3 Query: 291 VVTVAHRLPTVIEALIIIAFVEIRELE*DFASYVL 187 VVT+AHR+ TVIE+ +++ + R E D + +L Sbjct: 1427 VVTIAHRIHTVIESDLVLVLSDGRIAEFDSPAKLL 1461 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,665,113 Number of Sequences: 28952 Number of extensions: 112474 Number of successful extensions: 282 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 282 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 449370720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -