BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0980 (553 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35102| Best HMM Match : Spore_permease (HMM E-Value=2.7) 29 2.5 SB_26486| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_6273| Best HMM Match : MAM (HMM E-Value=0) 27 7.7 >SB_35102| Best HMM Match : Spore_permease (HMM E-Value=2.7) Length = 464 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/39 (30%), Positives = 24/39 (61%), Gaps = 3/39 (7%) Frame = +2 Query: 149 INALTICQGRLWTPCLHGSIKIFLCYIM---LYNRVAFL 256 + + +CQ +L+TP + +++F C ++ L+ RV FL Sbjct: 48 VTCIVLCQLQLFTPIVLCQLQLFTCIVLCQQLFTRVLFL 86 >SB_26486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -1 Query: 445 IRLDVSKTQLTGTWLRVGLALRVK*TSYTNLYITILLKN 329 + D TQL TW R G +RVK NL T LL++ Sbjct: 16 LHYDSHFTQLHKTWEREGALIRVKAVFSINLVPTALLRS 54 >SB_6273| Best HMM Match : MAM (HMM E-Value=0) Length = 4272 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +1 Query: 67 THIHSVFVWLHFHNRYLYIL*FIYK 141 T+ ++ VWL+F +YLY L F+Y+ Sbjct: 2172 TYGTALAVWLYFTWKYLYCLAFVYQ 2196 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,590,343 Number of Sequences: 59808 Number of extensions: 340498 Number of successful extensions: 542 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 542 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -