BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0980 (553 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21230.1 68417.m03070 protein kinase family protein contains ... 28 4.8 At1g02305.1 68414.m00175 cathepsin B-like cysteine protease, put... 27 8.3 >At4g21230.1 68417.m03070 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 642 Score = 27.9 bits (59), Expect = 4.8 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +2 Query: 122 FYSLSINLSINALTICQG 175 FY++SIN +NA+ +C+G Sbjct: 68 FYNISINGEVNAIALCRG 85 >At1g02305.1 68414.m00175 cathepsin B-like cysteine protease, putative similar to cathepsin B-like cysteine proteinase [Nicotiana rustica] GI:609175; contains Pfam profile PF00112: Papain family cysteine protease Length = 362 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 8/56 (14%) Frame = +2 Query: 38 TADAVASRVARTSTQYSCGYTFIIGT--------CIFYSLSINLSINALTICQGRL 181 TA + + + R Q CG + G CI Y+++++LS+N L C G L Sbjct: 114 TAWSQCTSIGRILDQGHCGSCWAFGAVESLSDRFCIKYNMNVSLSVNDLLACCGFL 169 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,393,518 Number of Sequences: 28952 Number of extensions: 225956 Number of successful extensions: 413 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 407 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 413 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -