BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0977 (389 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 65 1e-12 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 26 0.56 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 24 1.7 Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein... 22 6.9 AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 22 9.1 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 64.9 bits (151), Expect = 1e-12 Identities = 27/45 (60%), Positives = 39/45 (86%) Frame = +1 Query: 253 ESSSTINLTKEKFEVILDVQQFTPDEITVKASNNTVVVEGKHEEK 387 +S S +N++K+KF++ LDVQQF+P+EI+VK +N V+VEGKHEEK Sbjct: 3 DSGSAVNISKDKFQINLDVQQFSPEEISVKYVDNCVLVEGKHEEK 47 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 25.8 bits (54), Expect = 0.56 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = -2 Query: 157 SSDPCRSAGPVVWRGARCAPSHPTSRETSLVLSTS 53 S+DP R++GP W + P+S +++ ++S Sbjct: 213 SADPSRNSGPSSWMSGAGSVGGPSSAAAAMLSASS 247 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 24.2 bits (50), Expect = 1.7 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 307 VQQFTPDEITVKASNNTVVVEGKHEEK 387 ++++ P+E TV SN +V+G+ K Sbjct: 68 IEKYCPEEYTVDPSNTFQLVQGRELTK 94 >Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein protein. Length = 192 Score = 22.2 bits (45), Expect = 6.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +1 Query: 214 SYFRPWRASLARQESSSTINLTKEK 288 S+FR WR + + +TI KE+ Sbjct: 84 SFFRAWRNCIDEGKGLATIESEKEQ 108 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 21.8 bits (44), Expect = 9.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 364 RQPCCST 344 RQPCCST Sbjct: 171 RQPCCST 177 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 346,506 Number of Sequences: 2352 Number of extensions: 5852 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 30356973 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -