BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0977 (389 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49580.1 68418.m06136 DNAJ heat shock N-terminal domain-conta... 29 1.1 At5g46850.1 68418.m05773 expressed protein ; expression support... 29 1.5 At2g41450.1 68415.m05121 GCN5-related N-acetyltransferase (GNAT)... 27 3.4 At5g04750.1 68418.m00488 F1F0-ATPase inhibitor protein, putative... 27 5.9 At3g53160.1 68416.m05858 UDP-glucoronosyl/UDP-glucosyl transfera... 26 7.8 At3g14415.1 68416.m01824 (S)-2-hydroxy-acid oxidase, peroxisomal... 26 7.8 >At5g49580.1 68418.m06136 DNAJ heat shock N-terminal domain-containing protein contains similarity to S-locus protein 5 GI:6069485 from [Brassica rapa]; contains Pfam profile PF00226 DnaJ domain Length = 695 Score = 29.1 bits (62), Expect = 1.1 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 261 FDDQLDEREI*GYFRRSAIHSRRD-HGQGVEQHGCRRRQARGE 386 +DD+L E+ YFRR S++D G G G + GE Sbjct: 471 YDDELKREELLNYFRRFQNSSQKDTRGHGFSGSGFGSSEGEGE 513 >At5g46850.1 68418.m05773 expressed protein ; expression supported by MPSS Length = 296 Score = 28.7 bits (61), Expect = 1.5 Identities = 16/62 (25%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = +3 Query: 99 GAHRAPLQTTGPALRHGSEEGRPVILHQFIPLDLALQKFILQTLEGE--LSQTGIFFDDQ 272 G+HR + + L H + R +++ + +PL + F LQ+L+ S +F D Sbjct: 99 GSHRNLITSIKLLLHHSESQFRELVIVERLPLGVFADPFELQSLQQRRAFSDVSVFGDTN 158 Query: 273 LD 278 L+ Sbjct: 159 LE 160 >At2g41450.1 68415.m05121 GCN5-related N-acetyltransferase (GNAT) family protein low similarity to Swift [Xenopus laevis] GI:14164561; contains Pfam profiles PF00583: acetyltransferase, GNAT family, PF00533: BRCA1 C Terminus (BRCT) domain Length = 991 Score = 27.5 bits (58), Expect = 3.4 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +3 Query: 150 SEEGRPVILHQFIPLDLALQKFILQTLEGELSQTGIFFDD 269 S R +L F+PL LA F+LQ G +FDD Sbjct: 580 SSYSRKFLLITFLPLSLACLAFLLQWRSGVNDSVTQWFDD 619 >At5g04750.1 68418.m00488 F1F0-ATPase inhibitor protein, putative similar to F1F0-ATPase inhibitor protein [Oryza sativa (japonica cultivar-group)] gi|5106371|dbj|BAA81661 Length = 94 Score = 26.6 bits (56), Expect = 5.9 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +3 Query: 96 LGAHRAPLQTTGPALRHGSEE-GRPVILHQFIPLDLALQKFILQTLE 233 +GA R+ + T GPA+R+ S++ GR + + + +QK + LE Sbjct: 22 IGASRSVVSTRGPAIRYFSDDKGRVLSEEERAKESMYIQKMERERLE 68 >At3g53160.1 68416.m05858 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 490 Score = 26.2 bits (55), Expect = 7.8 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = -1 Query: 308 TSKITSNFSFVKLIVEEDSCLAKLALQGLKYEFLKSEVEGNE 183 TS++ F KLI SC + +++Q ++ + +E N+ Sbjct: 131 TSRLAKKFKIPKLIFHGFSCFSLMSIQVVRESGILKMIESND 172 >At3g14415.1 68416.m01824 (S)-2-hydroxy-acid oxidase, peroxisomal, putative / glycolate oxidase, putative / short chain alpha-hydroxy acid oxidase, putative similar to (S)-2-hydroxy-acid oxidase, peroxisomal (Glycolate oxidase, GOX) (Short chain alpha-hydroxy acid oxidase) [Spinacia oleracea] SWISS-PROT:P05414 Length = 367 Score = 26.2 bits (55), Expect = 7.8 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -1 Query: 266 VEEDSCLAKLALQGLKYEFLKSEVEGNELMEDNRSSFFR 150 V E +AK L + Y++ S E +++NR++F R Sbjct: 6 VTEYDAIAKAKLPKMVYDYYASGAEDQWTLQENRNAFAR 44 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,365,670 Number of Sequences: 28952 Number of extensions: 130270 Number of successful extensions: 419 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 419 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 557595584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -