Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-0974
         (650 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL441992-5|CAI15405.1|  205|Homo sapiens zinc finger, DHHC-type ...    30   8.2  

>AL441992-5|CAI15405.1|  205|Homo sapiens zinc finger, DHHC-type
           containing 12 protein.
          Length = 205

 Score = 29.9 bits (64), Expect = 8.2
 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 7/69 (10%)
 Frame = -3

Query: 450 KCESCLNSYQHKSP-----ISEVNEPFKVI*FQFQSVILHWDALTSKTRNVN--GQYRNK 292
           +C  C+  Y H  P     + E N P  V+    Q V+L W    + TR ++   Q R  
Sbjct: 115 ECRRCVRRYDHHCPWMENCVGERNHPLFVVYLALQLVVLLWGLYLACTRPLSPAPQVRPP 174

Query: 291 YYPPVQNIV 265
             P + ++V
Sbjct: 175 VLPALGSVV 183


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 90,639,984
Number of Sequences: 237096
Number of extensions: 1822788
Number of successful extensions: 3478
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3325
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3478
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7253890590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)