BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0974 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 5.9 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 21 7.8 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 21 7.8 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +2 Query: 467 YKNDRNLNLTYDEDDVPVPMSRRKRTPILCR 559 +K NLT++ED P R LC+ Sbjct: 106 FKEWGTTNLTFEEDPEPFGRVRDHNISALCK 136 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 73 FSVNCYCCVKRANYI 29 FS CYCC R +Y+ Sbjct: 87 FSKECYCC--RESYL 99 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 73 FSVNCYCCVKRANYI 29 FS CYCC R +Y+ Sbjct: 87 FSKECYCC--RESYL 99 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,399 Number of Sequences: 438 Number of extensions: 3338 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -