BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0970 (642 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6LMM9 Cluster: Putative uncharacterized protein precur... 34 3.4 UniRef50_Q6NR30 Cluster: RE38958p; n=2; Sophophora|Rep: RE38958p... 33 7.7 >UniRef50_A6LMM9 Cluster: Putative uncharacterized protein precursor; n=1; Thermosipho melanesiensis BI429|Rep: Putative uncharacterized protein precursor - Thermosipho melanesiensis BI429 Length = 159 Score = 33.9 bits (74), Expect = 3.4 Identities = 12/29 (41%), Positives = 22/29 (75%) Frame = -3 Query: 262 IRYYSILSVIYFICRIIQDVHGVQVRFRI 176 I Y+ +LS+ Y + RI+++++ + VRFRI Sbjct: 64 ILYFLLLSIFYQLYRIVREIYSIDVRFRI 92 >UniRef50_Q6NR30 Cluster: RE38958p; n=2; Sophophora|Rep: RE38958p - Drosophila melanogaster (Fruit fly) Length = 512 Score = 32.7 bits (71), Expect = 7.7 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -2 Query: 203 SWSSGAVSNPARSS*NCVVSLKTEPLLFSAINAQSYCNWAESF 75 S SS + S+ A SS NC LKTEP+L S N N+A ++ Sbjct: 271 SSSSSSSSSSASSSANCAKKLKTEPIL-SQYNQTERLNFANTY 312 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 564,184,172 Number of Sequences: 1657284 Number of extensions: 10636214 Number of successful extensions: 27289 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27284 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48126133708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -