BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0970 (642 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53578| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_3479| Best HMM Match : PAH (HMM E-Value=4.7) 28 5.6 SB_47389| Best HMM Match : 7tm_1 (HMM E-Value=0) 28 5.6 >SB_53578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -2 Query: 353 GLFLSTLPTTVNLSRLSAK*PFVII*HNKLYPLLFNIICNLFH 225 G FLS P T L A F++I K++PL ++ +LFH Sbjct: 853 GSFLSRTPITPRLMFREADLAFLMIKQEKMFPLA-ELLASLFH 894 >SB_3479| Best HMM Match : PAH (HMM E-Value=4.7) Length = 222 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 262 IRYYSILSVIYFICRIIQDVHGVQVRFRIRRV 167 +RYY + Y +C+++Q VH QV +R+V Sbjct: 140 VRYYKVCVRYYKVCQVLQSVH--QVLQSVRQV 169 >SB_47389| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 341 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 4/55 (7%) Frame = -3 Query: 337 PCPPQSIFQG-CLLN-SP--SLLFSIINFIRYYSILSVIYFICRIIQDVHGVQVR 185 P +S+F G C N SP SL+ S++NF+ ++ ++YF + H ++R Sbjct: 174 PLYEKSVFDGACHFNISPWYSLISSVVNFVLPTIVMCLLYFRIYKVAHAHARRIR 228 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,238,530 Number of Sequences: 59808 Number of extensions: 343315 Number of successful extensions: 819 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 819 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -