BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0967 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 77 8e-16 DQ007318-1|AAY24700.1| 153|Anopheles gambiae lysozyme c-4 protein. 24 4.4 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 76.6 bits (180), Expect = 8e-16 Identities = 43/76 (56%), Positives = 48/76 (63%) Frame = +2 Query: 488 NAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAACDCLRS*QKGYWENEMYLSLT 667 +AVITVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAA K L Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAA-LAYGLDKNLKGERNVLIFD 59 Query: 668 SAAVLLDVSXLTSEDG 715 DVS LT ++G Sbjct: 60 LGGGTFDVSILTIDEG 75 >DQ007318-1|AAY24700.1| 153|Anopheles gambiae lysozyme c-4 protein. Length = 153 Score = 24.2 bits (50), Expect = 4.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 73 STRSRXSIWVPRTLALVSSSTGKVEIIANDQGN 171 S+R+ S WV +A + T KV + ND N Sbjct: 49 SSRTLISNWVCLVMAESGADTSKVTKLPNDSAN 81 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 816,117 Number of Sequences: 2352 Number of extensions: 17065 Number of successful extensions: 31 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -