BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0965 (750 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC15A10.13 |ppk3||serine/threonine protein kinase Ppk3|Schizos... 27 2.9 SPAC1296.03c |sxa2||serine carboxypeptidase Sxa2|Schizosaccharom... 25 8.7 SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyce... 25 8.7 SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyce... 25 8.7 >SPAC15A10.13 |ppk3||serine/threonine protein kinase Ppk3|Schizosaccharomyces pombe|chr 1|||Manual Length = 637 Score = 27.1 bits (57), Expect = 2.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -3 Query: 226 HALMFIIILSVVRTKQSKTIVKLKKMKSKLFHAIPKS 116 H + +LS VR + + VKLK++ S IPK+ Sbjct: 263 HLITLYELLSEVRINEEEDRVKLKQLLSSKLEVIPKN 299 >SPAC1296.03c |sxa2||serine carboxypeptidase Sxa2|Schizosaccharomyces pombe|chr 1|||Manual Length = 507 Score = 25.4 bits (53), Expect = 8.7 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 5/52 (9%) Frame = -1 Query: 477 FPLWRPPDNIADRTGTLPYERLIGK-LDNCSNVI----FYTLMRFFRLIKHS 337 +P+WRP N + T E L G+ + N N I Y+L F +++S Sbjct: 292 YPIWRPEYNFSTSTSLRKREALDGEDIGNVFNSISGCDLYSLSNFLLYLENS 343 >SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 983 Score = 25.4 bits (53), Expect = 8.7 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 404 FPINLSYGSVPVRSAILSGGRHNGKKAL 487 F L G+ VRS I++G H+GK AL Sbjct: 129 FLFGLLTGTDDVRSFIVAGHLHHGKSAL 156 >SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2310 Score = 25.4 bits (53), Expect = 8.7 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 356 KNLISV*KITFEQLSSFPINLSYGSVPVRSAILSG 460 +N+ ++ + LSS P+ +SY P A+L+G Sbjct: 1832 ENIADCIELVYPSLSSKPVQISYDIYPNVPALLAG 1866 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,931,070 Number of Sequences: 5004 Number of extensions: 60604 Number of successful extensions: 117 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -