BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0965 (750 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58762-5|AAK39304.2| 496|Caenorhabditis elegans Hypothetical pr... 28 6.2 AJ431373-1|CAD24083.1| 496|Caenorhabditis elegans putative alph... 28 6.2 >U58762-5|AAK39304.2| 496|Caenorhabditis elegans Hypothetical protein T27F7.3a protein. Length = 496 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = +3 Query: 84 SYYKHVFICCKLFGIA*NSFDFIFFSLTIVFDCLVRT 194 S+YK CK GIA NSF + S VF C RT Sbjct: 101 SFYKICLRLCKTKGIAENSF-VTYLSSWFVFYCAPRT 136 >AJ431373-1|CAD24083.1| 496|Caenorhabditis elegans putative alpha 2 mannosyltransferaseprotein. Length = 496 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = +3 Query: 84 SYYKHVFICCKLFGIA*NSFDFIFFSLTIVFDCLVRT 194 S+YK CK GIA NSF + S VF C RT Sbjct: 101 SFYKICLRLCKTKGIAENSF-VTYLSSWFVFYCAPRT 136 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,871,620 Number of Sequences: 27780 Number of extensions: 330960 Number of successful extensions: 695 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1777507862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -