BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0958 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 5.3 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 9.3 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 9.3 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.3 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.3 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 150 ITDSFFDDGGSESPTSAV 203 I +S D+GG SP SAV Sbjct: 571 IINSSNDEGGKTSPNSAV 588 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/50 (18%), Positives = 23/50 (46%) Frame = +3 Query: 162 FFDDGGSESPTSAVGAEAPRELPNELSAPYEVPQFPIEQIEKKLLIQRQL 311 FF++ + G P + + + + P + ++Q+E+ + + QL Sbjct: 257 FFEEKDGQVLWEGFGDFQPVHVHKQTAIAFRTPTYRMQQVEQPVQVYIQL 306 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/50 (18%), Positives = 23/50 (46%) Frame = +3 Query: 162 FFDDGGSESPTSAVGAEAPRELPNELSAPYEVPQFPIEQIEKKLLIQRQL 311 FF++ + G P + + + + P + ++Q+E+ + + QL Sbjct: 257 FFEEKDGQVLWEGFGDFQPVHVHKQTAIAFRTPTYRMQQVEQPVQVYIQL 306 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -3 Query: 184 SLPPSSKNESVMISGDLEPSWTP 116 S+PP + + S L+ SW P Sbjct: 1112 SIPPEDVRCAALTSQSLQVSWQP 1134 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -3 Query: 184 SLPPSSKNESVMISGDLEPSWTP 116 S+PP + + S L+ SW P Sbjct: 1108 SIPPEDVRCAALTSQSLQVSWQP 1130 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,178 Number of Sequences: 438 Number of extensions: 3514 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -