BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0953 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4658| Best HMM Match : HTH_psq (HMM E-Value=0) 39 0.005 SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_40032| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_35073| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_56456| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_35284| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_29494| Best HMM Match : Mpp10 (HMM E-Value=0.62) 29 5.3 SB_24438| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_46841| Best HMM Match : zf-AN1 (HMM E-Value=2.4) 28 7.0 SB_41786| Best HMM Match : AT_hook (HMM E-Value=0.24) 28 7.0 SB_51968| Best HMM Match : PT (HMM E-Value=0.54) 28 7.0 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 28 9.3 SB_32089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_4658| Best HMM Match : HTH_psq (HMM E-Value=0) Length = 1595 Score = 38.7 bits (86), Expect = 0.005 Identities = 28/83 (33%), Positives = 43/83 (51%) Frame = +3 Query: 357 YDEVEYLEEDVTNNSQPEKDPITVCLTRPKKLPRAKPIKKYLQYTEEDLRNGVEAVRNNR 536 YD + ++ED + S P++D ++ P IKK+ ++EE +R +E V N Sbjct: 61 YDSPK-IDEDSKSESPPKRDH--------QQSPSTMSIKKFKLWSEEQMRMAIEHVLNGM 111 Query: 537 MSRLEAAEFYNVPRKTLVAKLKM 605 R AAE + VPR TL +L M Sbjct: 112 KIRA-AAEKFKVPRSTLGDRLLM 133 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +3 Query: 483 QYTEEDLRNGVEAVRNNRMSRLEAAEFYNVPRKTLVAKLKMDEESVD 623 +++EE + + A++ M AA + +P+ TL ++ +ES+D Sbjct: 333 KWSEEKMEQALVAIKTEDMPIRVAARKFQIPKSTLYDRVNRGDESID 379 >SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 31.5 bits (68), Expect = 0.76 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +2 Query: 44 SRQKNNDHRSNKEKTSKQASEEH*K*VNEIC-HRRPREDDGCIEKQKNLTYRYYKSQ 211 SR K + H S++ KTS+ H +E H R R + E+ ++ T R+ KS+ Sbjct: 77 SRHKTSRHESSRHKTSRHGRSRHKTSRHETSRHERSRHETRQHERSRHKTSRHEKSR 133 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +2 Query: 38 RESRQKNNDHRSNKEKTSKQASEEH*K*VNEICHRRPREDD 160 RE R++ R ++E+ K+ ++ + E RRPREDD Sbjct: 827 REDRERERREREDRERREKEEFDKRDRERREKDDRRPREDD 867 Score = 27.9 bits (59), Expect = 9.3 Identities = 16/69 (23%), Positives = 34/69 (49%) Frame = +2 Query: 35 KRESRQKNNDHRSNKEKTSKQASEEH*K*VNEICHRRPREDDGCIEKQKNLTYRYYKSQW 214 +RE R + + R ++++ ++ E+ + E RR RED +++ R K ++ Sbjct: 789 ERERRDREDRERRDRDERDRRDREDRERRDREDRERRDREDRERERREREDRERREKEEF 848 Query: 215 DFKQNLKRE 241 D + +RE Sbjct: 849 DKRDRERRE 857 >SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1913 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 378 EEDVTNNSQPEKD-PITVCLTRPKKLPRAKPIKKYL 482 E +VTN S+ + PI + +PK P+AKP K L Sbjct: 1085 EAEVTNESEETSEMPIYAAVQKPKDKPKAKPKPKEL 1120 >SB_40032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 628 HEKKCMYS*XEVKTLLSFHECDALQSXNIDLQLRLLH 738 HE K + S E K L+S HEC L S + L +H Sbjct: 76 HECKVLMSIHECKVLMSIHECKVLMSIDECSVLMSIH 112 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 628 HEKKCMYS*XEVKTLLSFHECDALQSXNIDLQLRLLH 738 HE K + S E L+S HEC+ L S + L +H Sbjct: 94 HECKVLMSIDECSVLMSIHECNVLMSIDECKLLMSIH 130 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 628 HEKKCMYS*XEVKTLLSFHECDALQSXNIDLQLRLLH 738 HE K + S E L+S HEC+ L S + L +H Sbjct: 139 HECKVLMSIHECNVLMSMHECNVLMSIDECKLLMSIH 175 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 628 HEKKCMYS*XEVKTLLSFHECDALQSXNIDLQLRLLH 738 HE + S E K L+S HEC+ L S + L +H Sbjct: 112 HECNVLMSIDECKLLMSIHECNVLMSIHECKVLMSIH 148 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 628 HEKKCMYS*XEVKTLLSFHECDALQS 705 HE + S E K L+S HEC+ L S Sbjct: 130 HECNVLMSIHECKVLMSIHECNVLMS 155 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 628 HEKKCMYS*XEVKTLLSFHECDALQS 705 HE K + S E L+S HEC+ L S Sbjct: 175 HECKLLMSIHECNVLMSIHECNVLMS 200 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 628 HEKKCMYS*XEVKTLLSFHECDALQS 705 HE K + S E L+S HEC+ L S Sbjct: 211 HECKVLMSIYECNVLMSMHECNVLMS 236 >SB_35073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 332 Score = 29.1 bits (62), Expect = 4.0 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = -3 Query: 250 SSNFSFKILFEIPL*FVVSIRKIFLLLDTTIVFSGSPMA--YFVNLFSMFFACLFGSFLF 77 + ++ + ILF +PL FV+ K ++ P+A Y V F +F A G L Sbjct: 146 AGSWIYAILFNLPLFFVIGYEKHGDDFRCPEKWTNKPLAELYTVGAFFIFGAIPIGIMLI 205 Query: 76 VGPVVI 59 V P++I Sbjct: 206 VYPMII 211 >SB_56456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1266 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +3 Query: 453 PRAKPIKKYLQYTEEDLRNGVEAVRNNRMSRLEAAE 560 PR P++ Y++YTEEDL + + +M+ EAA+ Sbjct: 114 PRKPPVQ-YIKYTEEDLDDYIPYEDPKKMAEKEAAK 148 >SB_35284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.1 bits (62), Expect = 4.0 Identities = 25/101 (24%), Positives = 49/101 (48%), Gaps = 8/101 (7%) Frame = +3 Query: 435 TRPKKLPRAK--PIKKYLQYTEEDLRNGVEAVRNN----RMSRLEAAEFYNVPRKTLVAK 596 ++PKKL + ++K ++TE++L+ A +NN +MS+ + E Y KT A Sbjct: 6 SKPKKLTDEEILELRKTTEFTEDELQKWFAAFKNNCPKGKMSQSKFCEMYAKSYKTGDAS 65 Query: 597 LKMDE--ESVDPAREEMYVFIXGSKNITLISRMRRPTKXKY 713 + + D + F + +++ISR + TK ++ Sbjct: 66 IFAGHVFRTFDKNNDGTIDFNEFIQGLSIISRGSKETKLRW 106 >SB_29494| Best HMM Match : Mpp10 (HMM E-Value=0.62) Length = 631 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +3 Query: 339 GLEKKTYDEVEYLEEDVTNNSQPEKDPITVCLTRPKKLPRAKPIKKYLQYTE 494 G E+K +EVE++E++ N+S+ EK+ + L P K +A K Y E Sbjct: 245 GEEQKEEEEVEWVEKEKVNSSEIEKE--SSRLQSPNKGKQATVRNKLTIYAE 294 >SB_24438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +2 Query: 44 SRQKNNDHRSNKEKTSKQASEEH*K*VNEIC-HRRPREDDGCIEKQKNLTYRYYKSQ 211 SR K + H S++ KTS+ H +E H R R + E+ ++ T R+ S+ Sbjct: 37 SRHKTSRHESSRHKTSRHERSRHKTSRHETSRHERSRHETRQHERSRHKTSRHETSR 93 >SB_46841| Best HMM Match : zf-AN1 (HMM E-Value=2.4) Length = 266 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 628 HEKKCMYS*XEVKTLLSFHECDALQSXNIDLQLRLLH 738 HE K + S E L+S HEC+ L S + L +H Sbjct: 22 HECKVLMSIDECSVLMSIHECNVLMSIDECKLLMSIH 58 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 628 HEKKCMYS*XEVKTLLSFHECDALQSXNIDLQLRLLH 738 HE K + S E L+S HEC+ L S + L +H Sbjct: 67 HECKVLMSIHECNVLMSMHECNVLMSIDECKLLMSIH 103 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 628 HEKKCMYS*XEVKTLLSFHECDALQSXNIDLQLRLLH 738 HE + S E K L+S HEC+ L S + L +H Sbjct: 40 HECNVLMSIDECKLLMSIHECNVLMSIHECKVLMSIH 76 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 628 HEKKCMYS*XEVKTLLSFHECDALQS 705 HE + S E K L+S HEC+ L S Sbjct: 58 HECNVLMSIHECKVLMSIHECNVLMS 83 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 628 HEKKCMYS*XEVKTLLSFHECDALQS 705 HE K + S E L+S HEC+ L S Sbjct: 103 HECKLLMSIHECNVLMSIHECNVLMS 128 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 628 HEKKCMYS*XEVKTLLSFHECDALQS 705 HE K + S E L+S HEC+ L S Sbjct: 139 HECKVLMSIYECNVLMSMHECNVLMS 164 >SB_41786| Best HMM Match : AT_hook (HMM E-Value=0.24) Length = 324 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +3 Query: 393 NNSQPEKDPITVCLTRPKKLPRAKPIKKY-LQYTEEDLRNGVEAVRNNRMSR 545 ++++P+ DP+ P K PR +P KK+ Q+ + V++ + R R Sbjct: 32 SDNEPKDDPVAEQPVMPIKRPRGRPSKKWQAQFLGKVFPEPVKSAKKERKPR 83 >SB_51968| Best HMM Match : PT (HMM E-Value=0.54) Length = 514 Score = 28.3 bits (60), Expect = 7.0 Identities = 36/130 (27%), Positives = 45/130 (34%), Gaps = 1/130 (0%) Frame = +3 Query: 348 KKTYDEVEYLEEDVTNNSQPEKDPITVCLTRPKKLPRAKPIKKYLQYTEEDLRNGVEAVR 527 K EVE EE T +P K T P + P KP K L EE+ E Sbjct: 268 KPLLPEVEPEEERAT--PRPTKAKPTTRKRMPTERPTKKPTKPLLPEEEEEEEEEEEERP 325 Query: 528 NNRMSRLEAAEFYNVPRKTLVAK-LKMDEESVDPAREEMYVFIXGSKNITLISRMRRPTK 704 R ++ + P + K K V+P EE T +PT Sbjct: 326 TPRPTKAKPTAIIRKPTERPTKKPTKPLLPEVEPEEEE---------RATPRPTKAKPTT 376 Query: 705 XKYRPTAAPT 734 K RPT PT Sbjct: 377 IKRRPTERPT 386 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 27.9 bits (59), Expect = 9.3 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 29 QTKRESRQKNNDHRSNKEKTSKQASEEH*K*VNEICH-RRPREDDGCIEKQKNL 187 Q KRE ++K + KEK +Q + K E+ RR +E+ +E+++ L Sbjct: 1184 QKKREEKKKREEEMREKEKEMEQNKIDQEKRKQELMESRRFQEEQDRLEEERRL 1237 >SB_32089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 9.3 Identities = 9/36 (25%), Positives = 20/36 (55%) Frame = +2 Query: 128 EICHRRPREDDGCIEKQKNLTYRYYKSQWDFKQNLK 235 ++C+ RPR ++K NL + + QW + ++ + Sbjct: 65 QLCNERPRHSTAVLDKDGNLLSKKEEIQWRWTEHFR 100 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,584,468 Number of Sequences: 59808 Number of extensions: 447076 Number of successful extensions: 1242 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1238 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -