BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0950 (350 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30D11.02c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 26 2.0 SPCP31B10.05 |||tyrosyl-DNA phosphodiesterase |Schizosaccharomyc... 25 4.5 >SPAC30D11.02c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 85 Score = 25.8 bits (54), Expect = 2.0 Identities = 9/37 (24%), Positives = 21/37 (56%) Frame = -3 Query: 246 ISSLINHCPSKILILQVFLSFSQNHFSVMMKLMRPVR 136 + L+ HC + + V L +++N F + + +RP++ Sbjct: 1 MGKLVKHCHTSLHSELVILFYAKNRFCISIDHLRPLK 37 >SPCP31B10.05 |||tyrosyl-DNA phosphodiesterase |Schizosaccharomyces pombe|chr 3|||Manual Length = 536 Score = 24.6 bits (51), Expect = 4.5 Identities = 8/32 (25%), Positives = 18/32 (56%) Frame = -3 Query: 252 SNISSLINHCPSKILILQVFLSFSQNHFSVMM 157 + +++ +NHCP + + V++ H S +M Sbjct: 95 ARLTAQMNHCPVNVKLYSVYVPMWGTHHSKIM 126 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,076,812 Number of Sequences: 5004 Number of extensions: 15583 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 106195544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -