BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0950 (350 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 1.4 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 4.2 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 4.2 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 20 9.8 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.6 bits (46), Expect = 1.4 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -3 Query: 237 LINHCPSKILILQVFLSFSQNHFSVMMKLMRP 142 +++ CPS ++ LQV ++ SQ ++ K P Sbjct: 853 VLSGCPSNMMELQVDIADSQQPLNLSKKSPSP 884 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.0 bits (42), Expect = 4.2 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 100 KYLDYTST*LNYPYWSH 150 KYL Y YP+WSH Sbjct: 518 KYLTY-----EYPWWSH 529 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.0 bits (42), Expect = 4.2 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 100 KYLDYTST*LNYPYWSH 150 KYL Y YP+WSH Sbjct: 571 KYLTY-----EYPWWSH 582 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 19.8 bits (39), Expect = 9.8 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 19 RYLYLPTVFLDFISVYVCRFK 81 RY+ PT F FI V RF+ Sbjct: 368 RYIGPPTPFPRFIPPNVYRFR 388 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,529 Number of Sequences: 438 Number of extensions: 1064 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8060325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -