BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0949 (350 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC109121-1|AAI09122.1| 711|Homo sapiens F-box protein 34 protein. 28 7.2 BC109120-1|AAI09121.1| 711|Homo sapiens F-box protein 34 protein. 28 7.2 BC095482-1|AAH95482.2| 711|Homo sapiens F-box protein 34 protein. 28 7.2 BC036528-1|AAH36528.1| 299|Homo sapiens chromosome 5 open readi... 28 9.5 >BC109121-1|AAI09122.1| 711|Homo sapiens F-box protein 34 protein. Length = 711 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 121 NCGNSRANTCNQNSDQ*WD 177 +CG SRA+ C+ DQ WD Sbjct: 349 DCGPSRADRCSPKEDQAWD 367 >BC109120-1|AAI09121.1| 711|Homo sapiens F-box protein 34 protein. Length = 711 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 121 NCGNSRANTCNQNSDQ*WD 177 +CG SRA+ C+ DQ WD Sbjct: 349 DCGPSRADRCSPKEDQAWD 367 >BC095482-1|AAH95482.2| 711|Homo sapiens F-box protein 34 protein. Length = 711 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 121 NCGNSRANTCNQNSDQ*WD 177 +CG SRA+ C+ DQ WD Sbjct: 349 DCGPSRADRCSPKEDQAWD 367 >BC036528-1|AAH36528.1| 299|Homo sapiens chromosome 5 open reading frame 35 protein. Length = 299 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 70 WLNISVLVP*ILLSYLDNCGNSR-ANTCNQNSD 165 WL + P + Y++NC N R AN C Q D Sbjct: 215 WLTSEIHNPLAVGQYVNNCSNDRAANVCYQEFD 247 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 46,589,979 Number of Sequences: 237096 Number of extensions: 806895 Number of successful extensions: 1487 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1487 length of database: 76,859,062 effective HSP length: 80 effective length of database: 57,891,382 effective search space used: 2084089752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -