BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0948 (750 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7QU06 Cluster: GLP_108_37491_40610; n=1; Giardia lambl... 33 9.9 UniRef50_A7RFU9 Cluster: Predicted protein; n=1; Nematostella ve... 33 9.9 >UniRef50_Q7QU06 Cluster: GLP_108_37491_40610; n=1; Giardia lamblia ATCC 50803|Rep: GLP_108_37491_40610 - Giardia lamblia ATCC 50803 Length = 1039 Score = 32.7 bits (71), Expect = 9.9 Identities = 17/59 (28%), Positives = 34/59 (57%) Frame = -1 Query: 417 KKKVQQFKQTNNRSNYLDIEF*LEIFDIKSKREIVVRDSNSHALKLTSSLYSLSARYFI 241 K+K +Q K+ N N +D++ E+ +++ +E ++ D NS +L + L L +RY + Sbjct: 490 KEKDRQIKECKN--NIIDLQN--ELTELRKNQEFLIADGNSTQSRLNAQLKGLCSRYAV 544 >UniRef50_A7RFU9 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 249 Score = 32.7 bits (71), Expect = 9.9 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = -2 Query: 536 HAKIKRVLS-LTYRSHNDKNGLAFTSVFXCITELI--CPIVLTKRRYNNLSKRITAL 375 HA+ ++S L +R H + + F V +T L+ CPIVL R + KR A+ Sbjct: 67 HARHSAIISPLRFRRHRSRCNIVFIVVSTWLTALVFTCPIVLLSRTTTGIGKRNCAV 123 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 622,697,786 Number of Sequences: 1657284 Number of extensions: 11180497 Number of successful extensions: 19647 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19644 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 61734884250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -