BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0940 (520 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U27312-9|AAA68252.1| 239|Caenorhabditis elegans Hypothetical pr... 29 2.6 AC006638-7|AAK85485.2| 491|Caenorhabditis elegans Hypothetical ... 27 8.0 >U27312-9|AAA68252.1| 239|Caenorhabditis elegans Hypothetical protein F26A1.11 protein. Length = 239 Score = 28.7 bits (61), Expect = 2.6 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -1 Query: 76 RDSFAANVLSLLQITYNKQHFHNIC 2 R SF NVL LQ Y ++F NIC Sbjct: 214 RASFVVNVLYNLQKLYKNKYFFNIC 238 >AC006638-7|AAK85485.2| 491|Caenorhabditis elegans Hypothetical protein F41G4.5 protein. Length = 491 Score = 27.1 bits (57), Expect = 8.0 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +2 Query: 125 IRHRSGFNGSEVRNLPEFPADQAARKDPSAAADGEGPTVQIRE 253 +R+R G S LP PAD A + P+A E PTV+ E Sbjct: 382 VRYRPGEGTSGAPTLP--PADDEADEHPAADDAEEPPTVEDTE 422 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,305,428 Number of Sequences: 27780 Number of extensions: 287241 Number of successful extensions: 807 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 765 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 807 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1007108110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -