BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0934 (650 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 28 0.077 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 28 0.077 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 24 0.94 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.2 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 2.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.8 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 27.9 bits (59), Expect = 0.077 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = +1 Query: 583 PTAAAIAYGX*QKRVLGERNVL 648 PTAAAIAYG K+ ERNVL Sbjct: 4 PTAAAIAYGL-DKKAEKERNVL 24 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 27.9 bits (59), Expect = 0.077 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = +1 Query: 583 PTAAAIAYGX*QKRVLGERNVL 648 PTAAAIAYG K+ ERNVL Sbjct: 4 PTAAAIAYGL-DKKAERERNVL 24 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 24.2 bits (50), Expect = 0.94 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +1 Query: 583 PTAAAIAYGX*QKRVLGERNVL 648 PTAAAIAYG +K E+N+L Sbjct: 4 PTAAAIAYGLDKKG--AEQNIL 23 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.0 bits (47), Expect = 2.2 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +1 Query: 343 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 468 D KPKI+ + ED+ E+ K K T + L KT Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.0 bits (47), Expect = 2.2 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 567 RIINEPDCCCDCLR 608 RI NE CC +C R Sbjct: 790 RIYNEKQCCKNCAR 803 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 113 TPTQEYVVPRSIPT 72 TPT + VV R+IP+ Sbjct: 15 TPTDQRVVTRTIPS 28 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,695 Number of Sequences: 336 Number of extensions: 3421 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -