BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0923 (650 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 23 2.2 AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esteras... 23 2.9 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 6.7 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 433 FT*KNYDIFSLCKQKYVHLFMYFKKHF*YIY 341 F+ NY S C+ + +FKK F YI+ Sbjct: 161 FSMLNYVYSSKCENNSTGVEHFFKKQFHYIF 191 >AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 296 KNLPAISCVFLKPLNIYI 349 ++LP C FLKP+ ++I Sbjct: 90 RDLPKEGCNFLKPVMVWI 107 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.4 bits (43), Expect = 6.7 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 535 SSTNKWQNYLWYTRYKRVFVGTGKNSRSXQGL 630 S+TN + NY +Y+ + T +S+ GL Sbjct: 248 STTNCYNNYPYYSNMDYLSSSTMSHSQFGNGL 279 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,696 Number of Sequences: 336 Number of extensions: 3319 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -