BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0922 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 23 3.4 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 23 3.4 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 6.0 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 8.0 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +3 Query: 630 HSGNGPGATAARCPGNGRSSDSVRP 704 H G GP T PG G ++P Sbjct: 377 HMGMGPSLTPLASPGCGPGQGGLQP 401 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +3 Query: 630 HSGNGPGATAARCPGNGRSSDSVRP 704 H G GP T PG G ++P Sbjct: 377 HMGMGPSLTPLASPGCGPGQGGLQP 401 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 232 SIHKLFSSSTSRPFPREGTASRH 164 S H+ FSSST + +ASRH Sbjct: 137 SCHQGFSSSTWCNYSAYSSASRH 159 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 100 KTQIPWNFTTDKLRSVTNLFGKLYVVWXRERR 5 +TQ P +T ++L T L VW RR Sbjct: 241 RTQYPDIYTREELAQRTKLTEARIQVWFSNRR 272 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,177 Number of Sequences: 336 Number of extensions: 4004 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -