BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0917 (620 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0183 - 21681673-21682524 29 3.0 01_07_0197 + 41912207-41912652,41913226-41913800,41913828-419157... 29 3.0 05_04_0396 - 20934444-20934969,20935042-20935316,20935447-20935581 27 9.1 >03_05_0183 - 21681673-21682524 Length = 283 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 159 SQAFIATLLFDPSMSALPIIAKQNSPS 239 SQAF A LL D + +A+P++ Q P+ Sbjct: 229 SQAFSAVLLADANRAAIPVVVVQKRPA 255 >01_07_0197 + 41912207-41912652,41913226-41913800,41913828-41915748, 41915836-41916049,41916143-41916394,41916469-41916528, 41916646-41916776,41916898-41917012,41917084-41917239 Length = 1289 Score = 29.1 bits (62), Expect = 3.0 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 98 YKEFLARG-ARKVTTGITGLWQPSVHSDVAF*SFDVG 205 YK F A G RKV GIT + PS+ D+AF S +G Sbjct: 633 YKIFQAFGLVRKVEKGITRWYYPSMLDDLAFDSAALG 669 >05_04_0396 - 20934444-20934969,20935042-20935316,20935447-20935581 Length = 311 Score = 27.5 bits (58), Expect = 9.1 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 371 GHLVHALGR-AAGGAKLPSAGLCLNASKAEXSLA 469 G LV L R GG SAG+C S+ + SLA Sbjct: 203 GRLVETLARDGGGGGGAYSAGVCFYGSRMDASLA 236 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,048,808 Number of Sequences: 37544 Number of extensions: 285908 Number of successful extensions: 693 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 693 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1502076244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -