BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0916 (410 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 1.5 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 3.6 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 20 8.2 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.6 bits (46), Expect = 1.5 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -2 Query: 232 GHAVGDIPGVR 200 G AVGD+PG+R Sbjct: 62 GTAVGDVPGLR 72 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.4 bits (43), Expect = 3.6 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +1 Query: 118 CTPMILVAPFSLCRERGET 174 C P + V P C E G T Sbjct: 163 CDPAVCVLPDCFCSEDGTT 181 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 20.2 bits (40), Expect = 8.2 Identities = 8/35 (22%), Positives = 18/35 (51%) Frame = +3 Query: 267 FSSMWFRQPSRGTNAXTFFPFLMSCTRTHLRMAEL 371 F+ +W + +RGT P +C + L ++++ Sbjct: 3 FAELWKKIRNRGTPPKFELPTTHNCLKKVLLLSQI 37 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,636 Number of Sequences: 336 Number of extensions: 1644 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8963165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -