BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0913 (600 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0709 - 35670153-35670350,35671206-35671259,35672444-356725... 70 1e-12 05_01_0594 - 5337804-5337976,5338282-5338436,5338591-5338745,533... 59 3e-09 12_02_0811 - 23370455-23370472,23372279-23372538,23372645-233727... 29 3.8 08_02_0076 + 11967606-11967905,11969125-11969223,11969813-119741... 29 3.8 11_03_0226 - 11908455-11908562,11915971-11916240,11916463-119169... 28 5.0 05_03_0355 - 12885898-12886290,12886351-12886644,12886744-128868... 28 5.0 08_02_1544 + 27787089-27787172,27787448-27787612,27787741-277878... 27 8.7 05_03_0089 - 8327044-8327142,8327238-8327306,8327413-8327504,832... 27 8.7 >03_06_0709 - 35670153-35670350,35671206-35671259,35672444-35672527, 35672688-35672902,35673959-35674058,35674178-35674276 Length = 249 Score = 70.1 bits (164), Expect = 1e-12 Identities = 33/99 (33%), Positives = 53/99 (53%) Frame = +1 Query: 220 DWYNGVPFFTRYWMTFTIVLSLFGKFGLVSPYYFILDFYYFFNQFQIWRPLTALFYYPIN 399 +WY +P TR ++T +V ++ ++SPY+ L+ ++IWR +T Y+ Sbjct: 7 EWYRQMPIITRSYLTAAVVTTVGCTLEIISPYHLYLNPKLVVQHYEIWRLVTNFLYF--- 63 Query: 400 PGTGFHFLINCYFLYNYSQRLETGMFAGKPADYFYMLLF 516 FL + +FL Y + LE F G+ AD+FYMLLF Sbjct: 64 RKMDLDFLFHMFFLARYCKLLEENSFRGRTADFFYMLLF 102 >05_01_0594 - 5337804-5337976,5338282-5338436,5338591-5338745, 5338864-5338992,5339096-5339189,5339293-5339366, 5339716-5339851,5341546-5341562 Length = 310 Score = 58.8 bits (136), Expect = 3e-09 Identities = 35/134 (26%), Positives = 65/134 (48%), Gaps = 2/134 (1%) Frame = +1 Query: 205 MSEFRDWYNGVPFFTRYWMTFTIVLSLFGKFGLVSPYYFILDFYYFFNQFQIWRPLTALF 384 MS ++YN +P ++ + T ++ + +++P + L + + F +FQIWR T+ F Sbjct: 1 MSSPAEYYNSLPPISKAYGTLCFFATVLCQLQILNPPFLALYYPFVFKKFQIWRLFTSFF 60 Query: 385 YYPINPGTGFHFLINCYFLYNYSQRLETGMFAGKPADYFYMLLFNWVCCVIIGLLAKLPI 564 + +F I + Y +LE G F + AD+ +M++F + + + + L I Sbjct: 61 FL---GKFSINFGIRLLMIARYGVQLEKGAFEKRTADFLWMMIFGAISLLALSAIPFLDI 117 Query: 565 --LMDPMALSALYV 600 L PM LYV Sbjct: 118 YFLGVPMVSMLLYV 131 >12_02_0811 - 23370455-23370472,23372279-23372538,23372645-23372713, 23372979-23373105,23373187-23373422,23373509-23373678, 23373855-23373935,23374013-23374084,23374273-23374344, 23374450-23374588,23375141-23375643,23376817-23377010, 23377952-23378488 Length = 825 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = +1 Query: 337 YFFNQFQIWRPLT--ALFYYPINP 402 + FN++Q WRP + LF YP +P Sbjct: 226 FAFNRYQFWRPASYYKLFRYPFDP 249 >08_02_0076 + 11967606-11967905,11969125-11969223,11969813-11974124, 11974177-11974211 Length = 1581 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +2 Query: 464 RLACLQGSQLTISTCFCLIGCAVL-SLDYLPNC 559 +LACL S T C+I C +L S++ LP+C Sbjct: 1274 KLACLDLSSCTALEKLCVIDCRLLQSIEGLPSC 1306 >11_03_0226 - 11908455-11908562,11915971-11916240,11916463-11916946, 11917148-11918060,11918628-11919300 Length = 815 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 448 SCTKSNSLSGNEILCLDLLDSKTK 377 SCTKS +L GN +L ++DS K Sbjct: 133 SCTKSTNLKGNGLLARRIVDSVAK 156 >05_03_0355 - 12885898-12886290,12886351-12886644,12886744-12886871, 12886952-12888482 Length = 781 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 448 SCTKSNSLSGNEILCLDLLDSKTK 377 SCTKS +L GN +L ++DS K Sbjct: 143 SCTKSTNLKGNGLLARRIVDSVAK 166 >08_02_1544 + 27787089-27787172,27787448-27787612,27787741-27787850, 27788360-27788513,27788643-27788937,27788996-27789798 Length = 536 Score = 27.5 bits (58), Expect = 8.7 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +1 Query: 298 GLVSPYYFILDFYYFFNQFQIWRPLTALFYY 390 G + Y F+ ++FF + I +P++ +FY+ Sbjct: 470 GCSAVYLFLYATFFFFAKLSIVKPVSVMFYF 500 >05_03_0089 - 8327044-8327142,8327238-8327306,8327413-8327504, 8327932-8329042 Length = 456 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 484 KPADYFYMLLFNWVCCVIIGLLAKL 558 KPA Y L NW C +IIG+L L Sbjct: 412 KPAKYSLSWLMNW-CFIIIGMLLML 435 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,168,997 Number of Sequences: 37544 Number of extensions: 297265 Number of successful extensions: 675 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 674 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1435654836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -