BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0913 (600 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 27 0.46 Z22925-1|CAA80505.1| 211|Anopheles gambiae ANG12 precursor prot... 27 0.61 DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reduct... 25 1.9 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 2.5 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 24 4.3 U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. 23 5.7 AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-tran... 23 5.7 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 23 7.5 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 23 7.5 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 23 7.5 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 23 7.5 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 7.5 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 23 7.5 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 27.1 bits (57), Expect = 0.46 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = -1 Query: 537 DNTAHPIKQKHVEIVSWLPCKHASLKSLRVVVQKV--TVYQEMKSCA 403 +N HPIK+ V I+S L C L + R+ ++ ++ + ++ C+ Sbjct: 116 NNVHHPIKKMAVSILSALACVERELMTTRLRAERTEKSLKEALEGCS 162 >Z22925-1|CAA80505.1| 211|Anopheles gambiae ANG12 precursor protein. Length = 211 Score = 26.6 bits (56), Expect = 0.61 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -2 Query: 284 KLNTIVKVIQYLVKNGTPLYQSRNSDIFQDFLIIS 180 +L+ + ++QYL + G P Y+S N + DFL +S Sbjct: 77 ELSAVRDLLQYLEEAGVPAYESLN--VVADFLGLS 109 >DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reductase protein. Length = 487 Score = 25.0 bits (52), Expect = 1.9 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 178 NEIIRKSWKMSEFRDWYNGVPFF 246 NE ++ EF WYNG+P F Sbjct: 138 NENLQNVLSAREFVAWYNGLPGF 160 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.6 bits (51), Expect = 2.5 Identities = 15/65 (23%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = +1 Query: 412 FHFLINCYFLYNYSQRLETGMFAGKPADYFYMLLFNWVCCVIIGLLAKLPI----LMDPM 579 F N +F+ ++ + M++ YF L + C V+IG + ++ + +M P+ Sbjct: 516 FQEYTNMFFVALFTMEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSIGEMILTSTQIMPPL 575 Query: 580 ALSAL 594 +S L Sbjct: 576 GVSVL 580 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 23.8 bits (49), Expect = 4.3 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 Query: 415 HFLINCYFLYNYSQRLETGM 474 H++I CY++Y R+ET M Sbjct: 101 HYVIRCYYVYT---RMETDM 117 >U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. Length = 278 Score = 23.4 bits (48), Expect = 5.7 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +3 Query: 537 HWITCQIANINGPDGTL 587 HW++ Q +NG DG++ Sbjct: 164 HWLSEQCNRLNGTDGSI 180 >AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-transferase u2 protein. Length = 222 Score = 23.4 bits (48), Expect = 5.7 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = -1 Query: 309 AYKPKF--TKQTQYNSKSHPISGE-KRYTIVPISEFRHFPRFSDYFVGTN 169 ++ PKF T ++ + IS E K T +++ H+ +DYF G N Sbjct: 106 SFYPKFFGTIGALFSGAATEISDEMKTTTQKALTDLEHYLTRNDYFAGEN 155 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 103 YVYLNRHACLLNTTSSKDSYHEI 125 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 103 YVYLNRHACLLNTTSSKDSYHEI 125 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 36 YCLIFRHRCLLGT**SYNFYEEI 104 Y + RH CLL T S + Y EI Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEI 136 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.0 bits (47), Expect = 7.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 460 VFESSCTKSNSLSGNEIL 407 VF+ SC SN S N+IL Sbjct: 748 VFDGSCKTSNGRSLNDIL 765 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 23.0 bits (47), Expect = 7.5 Identities = 13/52 (25%), Positives = 25/52 (48%) Frame = -3 Query: 502 RNSQLASLQTCQSQVFESSCTKSNSLSGNEILCLDLLDSKTKLLMDAISEID 347 R +L + + Q + + S + NSL D + + + LMDA+++ D Sbjct: 274 RKKELETSKAKQVAIGQRSTDEINSLEEKTERLEDTISKQKRELMDALAKAD 325 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 649,154 Number of Sequences: 2352 Number of extensions: 13340 Number of successful extensions: 124 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -