BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0909 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 2.3 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 23 3.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 4.0 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 9.3 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 9.3 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 9.3 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.4 bits (48), Expect = 2.3 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -2 Query: 629 SPSLG-LPRSGLAPLPPGNSPINVDTIEELPSL 534 SP+ G LP S AP+PP + N+ + LP++ Sbjct: 403 SPAGGQLPPSAGAPMPPIPNMSNMSGMPPLPNM 435 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -2 Query: 425 ASIRLFQLHQLPEVTFVGLVPGR*SLLRFLQ 333 +++R+ + H+L V VG+ PG+ L ++ Sbjct: 444 SALRILEKHELANVHPVGINPGKMQLKNIIK 474 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 509 RCLRERLPPNLEVLRWCRH 565 RC++ER E+LRW ++ Sbjct: 8 RCIQERRHIRRELLRWTKN 26 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 542 EVLRWCRH*LGSSQVAKALT 601 +++RWC G + KALT Sbjct: 384 KIIRWCTWSEGDLEKCKALT 403 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 542 EVLRWCRH*LGSSQVAKALT 601 +++RWC G + KALT Sbjct: 384 KIIRWCTWSEGDLEKCKALT 403 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 542 EVLRWCRH*LGSSQVAKALT 601 +++RWC G + KALT Sbjct: 384 KIIRWCTWSEGDLEKCKALT 403 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,174 Number of Sequences: 438 Number of extensions: 5436 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -